SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427737664|ref|YP_007057208.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427737664|ref|YP_007057208.1|
Domain Number 1 Region: 2-168
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1e-43
Family N-acetylmuramoyl-L-alanine amidase-like 0.00087
Further Details:      
 
Domain Number 2 Region: 268-311
Classification Level Classification E-value
Superfamily PGBD-like 0.000000000000377
Family Peptidoglycan binding domain, PGBD 0.0066
Further Details:      
 
Domain Number 3 Region: 181-254
Classification Level Classification E-value
Superfamily PGBD-like 0.00000000000392
Family Peptidoglycan binding domain, PGBD 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427737664|ref|YP_007057208.1|
Sequence length 313
Comment N-acetylmuramoyl-L-alanine amidase [Rivularia sp. PCC 7116]
Sequence
MRFGIDIGHNSPPDTGANGIKYEDNLTLDVGNRVIGKLKDLGYQVINCKPAKSDSVGDSL
RQRCAKANSSKVDIFVSIHFNAFNGFANGTEVFAASDTGKKIAKPVLDEILKMGFFNRGV
KNGSHLFVMKNTNMPAILVECCFIDSAKDMKLFNSESMANAIVKGLTGKLPSSPVISVPD
ETSNPDVSVIRLQKALNRLRMTDYSGKPLDEDNVIGQATISAIKNFQEIVDIQQTGIAGD
TTWGAINQVLAKPVMRKNHAGGIVMKYLQYRVGAEPDGIYGLFTEAAIQQFQRANGLYAD
GIVGNLTWRKLVE
Download sequence
Identical sequences K9RGM3
WP_015120223.1.44015 gi|427737664|ref|YP_007057208.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]