SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427737809|ref|YP_007057353.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427737809|ref|YP_007057353.1|
Domain Number 1 Region: 4-69
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.00000000000000743
Family 7-Fe ferredoxin 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427737809|ref|YP_007057353.1|
Sequence length 75
Comment hypothetical protein Riv7116_4384 [Rivularia sp. PCC 7116]
Sequence
MAHTIVTDVCEGVADCVDACPVACIHPGPGKNVKGTDWFWIDFATCIDCGICIQVCPVEG
AIVPEEQPELQKTPQ
Download sequence
Identical sequences K9RH13
WP_015120368.1.44015 gi|427737809|ref|YP_007057353.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]