SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427737817|ref|YP_007057361.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427737817|ref|YP_007057361.1|
Domain Number 1 Region: 8-137
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.91e-17
Family MarR-like transcriptional regulators 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427737817|ref|YP_007057361.1|
Sequence length 144
Comment transcriptional regulator [Rivularia sp. PCC 7116]
Sequence
MSISIPKDLPDPREFTGFVFWQKANNWEKYVNSQLEAYNISQSEIFQMISISILLNQQEE
VTQVDIANFTGVAAMSVSKVLKKLEKKEFITRETGTDSRAKSLKITQKGLDVLIRSANTL
FESNQSFFPTKNGEQFFNYLQQLK
Download sequence
Identical sequences K9RHM0
gi|427737817|ref|YP_007057361.1| WP_015120376.1.44015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]