SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427737942|ref|YP_007057486.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427737942|ref|YP_007057486.1|
Domain Number 1 Region: 16-335,443-480
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 8.2e-48
Family FAD-linked reductases, N-terminal domain 0.0028
Further Details:      
 
Domain Number 2 Region: 317-427
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 2.09e-24
Family L-aminoacid/polyamine oxidase 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427737942|ref|YP_007057486.1|
Sequence length 504
Comment monoamine oxidase [Rivularia sp. PCC 7116]
Sequence
MLTSTLLDMCEMTNLQPGKKVTILGAGIAGLVAAYELERLGHEVEIIEGSSRIGGRVWTH
RFGKDNDAPYAELGAMRIPSSHHHTLHYVEEMGLSDKLCKFMTVFEEQNAFINLEGKIFK
MKDAPRIFQQRYQGIFTDTRYSETTRLFAAWLKTIVDTISPGDLREGLQNDLESHLMDEL
ERLDLEPYFSEDKESIDLQLFIKQNPGFRARCSKALDMFFEDIVVETGKDLLQLQGGMQQ
IIDRLVEYIKSPIKCNQKVVAVRVNPEFTEIDIIENGERYTRKCDYVLCTIPFSVMRKME
LAGFDERKLDSIHDTYYCPATKVAFHTQEAFWQKQGIKGGASFSGEGVRQTYYPSVKFTP
DSGSVMLASYTIGDDADRMGMMSESQRHDYVKDVVGKVHPELQSENMVVEAASIAWGNYE
WSAGGCAVHWEDEAANTSNYLEAARRQHQLLFAGEHCSRYPAWLQGSIESALEAVYDIVS
DKRRDYFGTTSVNQRQDASVLQAA
Download sequence
Identical sequences K9RI20
WP_015120501.1.44015 gi|427737942|ref|YP_007057486.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]