SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427738035|ref|YP_007057579.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427738035|ref|YP_007057579.1|
Domain Number 1 Region: 23-251,283-370
Classification Level Classification E-value
Superfamily Pectin lyase-like 1e-30
Family Filamentous hemagglutinin FhaB, secretion domain 0.0058
Further Details:      
 
Domain Number 2 Region: 767-902
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000691
Family Filamentous hemagglutinin FhaB, secretion domain 0.075
Further Details:      
 
Domain Number 3 Region: 624-798
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000785
Family Filamentous hemagglutinin FhaB, secretion domain 0.094
Further Details:      
 
Weak hits

Sequence:  gi|427738035|ref|YP_007057579.1|
Domain Number - Region: 915-1036
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000691
Family Filamentous hemagglutinin FhaB, secretion domain 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427738035|ref|YP_007057579.1|
Sequence length 1332
Comment filamentous hemagglutinin family domain-containing protein [Rivularia sp. PCC 7116]
Sequence
MLKKSIHWGWLLKLALVNIGIFWVNSADAQIIPDSTLINNSTVKKQGNRNIIEGGSTAGS
NLFHSFQEFGVVNGGEAYFNNSVEINNIITRVTGSSISNINGLIKANGTANLFIINPNGI
AFGENAKLDIGGSFIGTTADSIKFADDIEFSAKNPKNKPLLTVNLPLGLQYGENNSNISS
NISNSGSLTVGEGKNITLIGNSFENLGNLKTKGGQISIAAISPQGFVSLGNSGEILGIDG
NTNSIGKVINLGKIDASNLQGVGGKVTVFGDRIGLLENSFFDASGTVGGGEIIIGNSDTK
AVYIDSEALLQSNALNRGDGGNISIFASESTRVYGSFSAKGGINNGNGGKVETSGNNFLD
ITGTTVDTNANNGLNGDWLLNSGNIFFGSTSSFDSTADKNDLEIFQPLNNTTILDSSTIE
KQLTAGNNLTITARKTGNQNGNIQADKLNIITNNNTPVTLTFAADNDIALSEGNIIAALD
TTGLIFQADRDADGKGKLSIGKNSEAISVVLQTTGGKFDASASGDILLSNAAILSTNTAA
NNSESMAIATKGSLILQKSYIVKDKSGAGNNGEINIEAANSVLRETSSISNKVNGVSNSG
DINIKGNSLSLQDDSTISNDTYGNGNAGNIDIQLNRLSVKSGAISSVTEGNGNSGLIKIE
TDIFDLNQGPIQSTTLGNGDAGDIIFNTKSFSLIDGALSTKTEAKGNAGDIEVNAIDNIL
ISNGGALTSDSNGEGDAGNINLNTNSLVLNRGVIASKANAYDNNFTSPANAGDINIEADS
VSLQNRSTISSTTQGNGNGGLIKIESNIFDLNKGSILSTTLGNGNAGKIIVNTKLFSLTD
GAFITKTEAKGDAGDININAIDEIFIDNIGVLTSDSNGEGNAGNINLITNSLILSNQSVI
ASKANAEDNNFSSPANAGNINIEANDILLDNNSVITSDTSVTGNAGEIKLKATNITLKSF
SNIIAIADENSTGNAGKITLTARDILFENDAKSVEDNPEKSNSLIGITEGKGNAGEINIT
AEKVILRNQGAIETSTRGEGNAGRLTLNTSLLQVENSRTQNRGGITSGSVGSGKAGELVI
NADKILLNNSDIEAETKSGNGGDIDINLKDVLILRNGSLITTNAGTEQLGGDGGNINIDA
KFIVALPEEDSNITANAFSGKGGMVNVKTNGIFGIFPQNRPTKFSDITASSELGVSGEIN
INRTAIEPAQGLIELPTSLVDASQEIVRDCNSEQTETASSFISTGRGGLPLNPYEPLTEF
ETIANWVTLTNQNNQQTRKIKLETPKKSTSRQKIVEAQGWIENSRGEIEFVAQLPKGYSS
NVSQQSDCDVMQ
Download sequence
Identical sequences K9RIV7
gi|427738035|ref|YP_007057579.1| WP_015120594.1.44015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]