SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427738215|ref|YP_007057759.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427738215|ref|YP_007057759.1|
Domain Number 1 Region: 192-619
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 4.59e-115
Family Myeloperoxidase-like 0.00000179
Further Details:      
 
Domain Number 2 Region: 630-710
Classification Level Classification E-value
Superfamily CalX-like 1.83e-21
Family CalX-beta domain 0.00073
Further Details:      
 
Domain Number 3 Region: 3-118
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 7.24e-20
Family Myeloperoxidase-like 0.0019
Further Details:      
 
Domain Number 4 Region: 805-995
Classification Level Classification E-value
Superfamily beta-Roll 7.98e-16
Family Serralysin-like metalloprotease, C-terminal domain 0.0047
Further Details:      
 
Domain Number 5 Region: 672-776
Classification Level Classification E-value
Superfamily beta-Roll 0.000000000144
Family Serralysin-like metalloprotease, C-terminal domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427738215|ref|YP_007057759.1|
Sequence length 1018
Comment heme peroxidase family protein,Calx-beta domain-containing protein,putative calcium-binding protein [Rivularia sp. PCC 7116]
Sequence
MIQFRTINGSDNHPENLGEAGSLLRRLLKPAYEDGFNLPRGITESQPGNPFIGPSQLPNP
RKISNAISAQTKSVPNSIDASDWIWQWGQFLDHDLDLNEGGNEAFFIPVDADDPIADNLP
RLGVAQSQLNVNVNARQASASALQPSGLILPFLGNTAPENLPAVDSLVSNAEVREENAEV
GIAQLESPSQRQAGTPFIPLTRITAAPGTGIEGKPRQQVNLITSFIDGSQVYGSEKDRAD
FLRANSSGELKSQNINGEELLPFNTANPPFPNGNPLGLPQEELFIAGDPRANEQVGLTAA
HTLFVREHNSIAEDIARRIAAGDSDILNLLEHSGLSKNDFIYESARKVIGAQIQQITYND
YLPLLIGKNLVENYSGYKPNVDPRISQEFANVSFRLGHSQLSPELRRVNPDGTSAGTIPL
GEAFFTPDKIINNGADSLLAGLTTQQSQAVDNLVVDGVRNFLFGVGTDAPATGGFDLAAV
NIQRGRDVGLPSYNDARRALGLRPATAFLTTDRRQGITSDPEVAARFASIYDSVEQVDFW
IGGISEDPVNGGLVGELFSKVLIDQFTRLRDGDRFFYLNQLEDLLVLDPDLQTTTLSDII
SRNTDPDYIIQENAFIVPNLSIDDANSSKEGLLEFVVNLSDVSSSIVTVDFETIDGTATK
GEDYAESKGTLTFNPGETSKTITVNLLNSSVLEDNETVLVKIDNASNQNIEDNLAVSKPI
VNREIKGTDFNDYLKGTFGNDLIEGLSGNDKIFGRFGNDYLDGGEGDDKINGDSNFGRRS
QLNRKSFSTELSNNDIRQNRFSRLDSNDTQLGGNGNDTLNGGFGKDTQLGGDGNDVLNGD
FKFGGFSRNSYRQNRQIESNNLSNLVSKPKNIEFGSGFLNSDDVQIGGNGNDTLNGGFGD
DELTGVGNQFGMGEIDNLTGGFGRDTFSLGDKNNVFYQGKGIFDYALITDFRASQDTIVL
KGEASDYVLGAIDNSELPRGTGLYFDANKSGDFTVGVDDLIAVVTQKISNFEQGFSFV
Download sequence
Identical sequences K9RJE1
WP_015120771.1.44015 gi|427738215|ref|YP_007057759.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]