SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427738240|ref|YP_007057784.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427738240|ref|YP_007057784.1|
Domain Number 1 Region: 585-760
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.11e-32
Family Leech intramolecular trans-sialidase, N-terminal domain 0.053
Further Details:      
 
Domain Number 2 Region: 818-1119
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 4.32e-30
Family Integrin alpha N-terminal domain 0.0038
Further Details:      
 
Domain Number 3 Region: 146-455
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 2.35e-24
Family Integrin alpha N-terminal domain 0.012
Further Details:      
 
Domain Number 4 Region: 1665-1874
Classification Level Classification E-value
Superfamily beta-Roll 8.72e-16
Family Serralysin-like metalloprotease, C-terminal domain 0.0053
Further Details:      
 
Domain Number 5 Region: 1228-1321
Classification Level Classification E-value
Superfamily beta-Roll 0.000000000384
Family Serralysin-like metalloprotease, C-terminal domain 0.0022
Further Details:      
 
Domain Number 6 Region: 479-564
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000126
Family Cadherin 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427738240|ref|YP_007057784.1|
Sequence length 1937
Comment laminin G domain-containing protein [Rivularia sp. PCC 7116]
Sequence
MKLLTPDSDGLFQVGVTEDIIIDPDKLTAGARRRASLGYYFLDAYGNYIEGRIVYADVTN
ESNRQSISIKKEELPVGAVKLGFFLIEDGAINNPGLSNGDRITFNANKNLFKNGTALSGS
VLFANSYSGSPVTTTTIPTLEQVKFLQGDFNGDGKDDLARIFNDAGQASIDVFLSRGDKF
VMHRWATQQGGYWDEQQWVIGDFNGDGKDDLAKAFNDRGLASLDVHLSNGNSFGIHKWAT
QQGGFWDAQKWVSGDFNGDGKDDLAKAFGVGGLAYIDTHISNGGSFAMQHWAAAQGGFWD
AQKWISGDFNGDGKDDLANVFNNAGGANIDVHLSSGSNFGIQHWAYQQGGFWDSQKWVSG
DFNGDGKDDLAKVFNNAGGANIDVHLSSGSNFGIQHWANQQGGFWDAQKWITGDFNDDGK
DDLANVFNNGELASIDVHSSTGINFGGQRWGLVQHGVGEVQLGYLIKESAEVSQMLGRHR
FNINENSINGSVVGTIATSGINKYKILAGNEQGIFAINRHTGEIKVANYNFLDYEADKFH
QLKVQTTDVNQSLDNLYVDIDVNDVVVEPPSGHMNHTLSLNVGTNFYESAHTILSEPATN
VTHELWFRTTDPNAGIFSIIGSANPDRAIFLQNGILHANNFNDSLNYVTAHGQNLADGNW
HHVAHVIDGSLNQQRLYVNGQFVGVGTGGASPITYNNHLHIGYAPHSNSKYFRGDIDEVR
VWNKAKTQAEIQQTMYKSLQGNESNLLGYWNFDNNSAEDVSVNNHNLVLAKNPTKLGVKL
YDGGSLFTGIDLTEPLGNAHQLIQVSSWDHARFNVTPTHSMVSGDFNGDGIDDIIRTGYH
PEVHLANGDGTFSKKGILDIGFRFDVYDLLIGDFDGDGRDDIIRQAKNGANYTVVMLSNG
DGTFRYQSNISGLHLPGHVTDIVVGDFNGDGKDDFIRQEQHGDRSNDAVVYLSNGDGNFT
YTSDISGLYLLGHEAEIVVGDFNGDRKDDFIRYKKRGANGINDAVVYLSNGDGNFTYTRD
IGSSLGLWGRGAATISVLDFNGDGRDDFIRREEGGAGSDEINSAQVLISNGDGTFTSQGN
LLQANDMRGYYVLRGPSGNHPYYYAGSNVITGDFDGDGKDGFIIQKLPTVWEKPHSSWWK
SGFFGNITGAFNSLGNAVVDAATDVADTFEGIAGDIADFTEDAAKTVAEGIGDLLGDWWL
KYYLEYIPSPYKKSNSTGHTINMVGGGVAYGEGGNDTMNAYAIAVSLHGGSGNDDINSYS
GASFIYGDSGNDSIDAYGGVNFVNGGTGDDTINSYGGANVVLAGSGTDNVTVAGFANVIH
SSGGYYESMTGLGGGNVFIKTGDGTEGITGGAGLNVFAKLANGDSTMVAHGAFNILTKVG
YGNDTLMALGAGNLITKIGDGTSTITGGSSQNIITSWGDSKDTIGAVGMVNAMIAGGNDD
IVIALGKGNIAFGDSLDPIIAESISAVFQTGEVLSAGADAVLDKVTDFKLSDAIKSAADI
ATAPVSGNDTLVTLGMKNAVVGGLGQDIAVVGGLHNFVFGDYISDFSLSDISVSIDSLLP
DLSFDFDFDFHLPDFGDFSFPSLPNFNLPSIGLPNLPDISALIPDINLPDLPGLNIPSIA
LPSLSLPSLNFTLPDISFNLPQRFQFKFLEDNGDLIFAGGKLNLISGDRGDDILVSGGNT
NTITGGEGKDLVLSGGKTNIVKGGDGDDLVFTAGSSNVVYGNNDNDTLIAAGRKNTIDGG
NGVDILLGLGYKNTIRGGDDKDFLIGVSYQPGKKDKNGNPIVQGGNTLDAGAGDDWLFAG
GENNTFSGGEGNDKYLFDGLTQSGDTTINNEGDDSSEDRLLFGGLNLSFSKDNNDLKVSY
NGNSDDALILKDWFVAGKEVERVDRFENIGLVLIDNVTNQDIPTGFNTNKIDWNASQWNS
NNQVSFASLAFEAADIF
Download sequence
Identical sequences K9RJG9
WP_015120796.1.44015 gi|427738240|ref|YP_007057784.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]