SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427738349|ref|YP_007057893.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427738349|ref|YP_007057893.1|
Domain Number 1 Region: 509-694
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.00000000000000131
Family Retroviral integrase, catalytic domain 0.082
Further Details:      
 
Weak hits

Sequence:  gi|427738349|ref|YP_007057893.1|
Domain Number - Region: 73-162
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 0.0361
Family Hedgehog C-terminal (Hog) autoprocessing domain 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427738349|ref|YP_007057893.1|
Sequence length 908
Comment integrase family protein [Rivularia sp. PCC 7116]
Sequence
MLSTQEFEEWCRRLKLPEVTRKVISQIRSTEPVRQVKSLGGNVSGNYCSQKMGKTLQFES
HKVELPGIEEYETCSDVLEFYDQPYQLTLKFMTKKGREVTVTHIPDFFVIRQQSAGFEEW
KPQAKLEKLSLLQPNRYVKNQDGQWTSPPAEEQAQLYGCYYRIRSDAEIDWIKYRNRQFL
RSYAEQKYQIGTEIATFIKSLVSSQPGITYLKLLQYQNVNPDHINALLATEELYIDLSAA
PLAEPEKVHIFRNQEMALAHNLTSVSQNLTVANSLQIIDVAVGTSFCWDGQPLTVLHNGE
SKIVLRSSNSLIHLTHSEFDLLVQRGEIVGLKVPEQIGIHPEAIERFLKASPQALAEANK
RYLVIEPYLHGQKRENETVSLRTIRNWKAKFKAAEQKYCWGYIGLIDNHAAKGNRLPKIS
TEVWEFVDKIIESHYETLKQRGKLAVYGVLSQEWEKAGRIEHLPSYVTFSSRIKQRSGYQ
QTKKRLGSRAAYQKSNFYWELEFTTPRHGDRPFEICHIDHTQLDIELVCSRTGRTLGRPW
ATLLIDATSRRILAIYLTFDEPSYRSCMMVLRICVQRFSRFPETIVVDGGAEFGSTYFET
LLAAFGCTKKQRPAAKARFGSVIERIFGTTNTEFFYNLRGNTQITKNVRVVTKSNNPKGQ
AVWTLDELYEHFCAYSYELYDCKEHPALLQSPRQAFLSGLALSGSRPHKKILYDQNFRIF
TLPSTPKGTAKVQPSRGVKINYLYYWSVDDSFINPEVEGTNVPVRYDPFDMGTAYTYVKG
QWVRCISDYYKSFHNCSEREVKLASLELHRSRQKVSQVITISAKEKAAYLESAEAKEVLL
LQRLHDLARLDVHSIIEGERSGHNHPQNIALNQKNPELDTNFNSTKDESVILEHLNTIEP
YKNEELWK
Download sequence
Identical sequences K9RIM8
gi|427738349|ref|YP_007057893.1| WP_015120905.1.44015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]