SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427738414|ref|YP_007057958.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427738414|ref|YP_007057958.1|
Domain Number 1 Region: 34-340
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.32e-27
Family Filamentous hemagglutinin FhaB, secretion domain 0.0073
Further Details:      
 
Domain Number 2 Region: 797-853,905-931
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000408
Family P22 tailspike protein 0.074
Further Details:      
 
Domain Number 3 Region: 663-791
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000345
Family P22 tailspike protein 0.037
Further Details:      
 
Domain Number 4 Region: 436-652
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00001
Family Filamentous hemagglutinin FhaB, secretion domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427738414|ref|YP_007057958.1|
Sequence length 1166
Comment filamentous hemagglutinin family domain-containing protein [Rivularia sp. PCC 7116]
Sequence
MTIRLCCWIRSTIGILSFFSIVGTSTLFTNKVVAQITPDASLGTESSRVKPLNQLLEQID
GGAIRGTSLFHSFQDFNIKEGRGAYFSNPVGIENIIGRVTGENYSQILGTLGVLGNANLY
FINPNGIIFGQNARLDINGSFSASTNSLILSDGSKFSSTISQEKPLLTVNLVKPIGFDVE
VEKRNTTITNTGNLSVGQDLTFVADNIDLQGKLQAGRDLTLQAQDTVKIRDSATNPFIAQ
SGRNLVIQGNQEVDIFALNHPNSGLFSGKDMTLRSANDVLGDSHYQTGGNFRIEKLDGSL
GNLFSPYDPVLLASGNVNLGDYTGASLHILAGGSVTLNNVTINDTDTEQNTISPSNNNLF
NGVNSFADLANINLSDKQRTSITVDGSKQPTLDIRAGIDWSQLGGLPIPDPNQQDSNSSF
SNTQPTITSPPLTADITVNGRININQPDGLVLLTNQYFPNQTLPGGKIQVGEINTARDVD
GNSGSISIDSKADIEPKGNSSSIFIDSKGNIEPKGNIDTSAYASSNNGNAGNINLITKGL
FSLINNTIISHTYGAGKGGDIYIEAESVNLNDGGTVKSKTFGKGNGGNITLEVSNAFNIN
SIKENNSESGLFTASAGDGDDSTTEDGGAGNLKVNTRTLIVRNGGQLGSDNFEENNDRFG
SGKSGNINIFAEESVEVSGTSNNLAGADGLLKPTSIASFTINNKDAGDLTIETKRFTVKD
GASITATTDGIGNSGILAIIADESMEVSGISSDGKGSRVRNATFGAGDSKDLIINTKRLV
VKDGGRIDSRTQPSSFSNQNTGNAGNIKITTDIFEAYNGGQVISSTGGTKKHNSGNAGEI
NINATEKVILSGVDSSFEQRSEDLKQTLTKNFPTQTEDVIDILLAARISEESSSGVVVKA
KDNRTGSAGNITIETPFLSIEDGAQLNAETVTAEGGNITLQLQDLLLMRRNGDITTNAGG
TGNGGNVNIDSGFVVAVPNEDNDIIARAVRGNGGNIKIDTQGIFGFQVSDQLTPRSDISA
SSDFGVDGVEEINAPDVDPSRGTVNLPDTPVNLNLAQGCQPSGLNSISRFTSIGTASIPA
NPNDIQNIYTLWEDLRSPTAQNTDSVDSTDSKSPRNSADIAAKEEIEKIQEAQGWIKTPD
GKVKLVVKSPTVTPYSSWQTPSACNE
Download sequence
Identical sequences K9RIT1
gi|427738414|ref|YP_007057958.1| WP_015120970.1.44015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]