SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427738517|ref|YP_007058061.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427738517|ref|YP_007058061.1|
Domain Number 1 Region: 1950-2075
Classification Level Classification E-value
Superfamily beta-Roll 2.35e-24
Family Serralysin-like metalloprotease, C-terminal domain 0.00043
Further Details:      
 
Domain Number 2 Region: 1490-1653
Classification Level Classification E-value
Superfamily beta-Roll 2.75e-20
Family Serralysin-like metalloprotease, C-terminal domain 0.0023
Further Details:      
 
Domain Number 3 Region: 681-830
Classification Level Classification E-value
Superfamily beta-Roll 1.31e-19
Family Serralysin-like metalloprotease, C-terminal domain 0.0034
Further Details:      
 
Domain Number 4 Region: 781-959
Classification Level Classification E-value
Superfamily beta-Roll 2.88e-19
Family Serralysin-like metalloprotease, C-terminal domain 0.0027
Further Details:      
 
Domain Number 5 Region: 1687-1739,1780-1814,1874-1930
Classification Level Classification E-value
Superfamily beta-Roll 0.00000000000000105
Family Serralysin-like metalloprotease, C-terminal domain 0.0033
Further Details:      
 
Domain Number 6 Region: 1159-1279
Classification Level Classification E-value
Superfamily beta-Roll 0.0000000000000275
Family Serralysin-like metalloprotease, C-terminal domain 0.0019
Further Details:      
 
Domain Number 7 Region: 966-1060
Classification Level Classification E-value
Superfamily beta-Roll 0.00000000000719
Family Serralysin-like metalloprotease, C-terminal domain 0.0026
Further Details:      
 
Domain Number 8 Region: 565-654
Classification Level Classification E-value
Superfamily beta-Roll 0.000000000115
Family Serralysin-like metalloprotease, C-terminal domain 0.0025
Further Details:      
 
Domain Number 9 Region: 1279-1374
Classification Level Classification E-value
Superfamily beta-Roll 0.000000000484
Family Serralysin-like metalloprotease, C-terminal domain 0.0021
Further Details:      
 
Domain Number 10 Region: 1066-1167
Classification Level Classification E-value
Superfamily beta-Roll 0.00000000981
Family Serralysin-like metalloprotease, C-terminal domain 0.0028
Further Details:      
 
Domain Number 11 Region: 420-537
Classification Level Classification E-value
Superfamily beta-Roll 0.0000000136
Family Serralysin-like metalloprotease, C-terminal domain 0.0018
Further Details:      
 
Domain Number 12 Region: 1378-1463
Classification Level Classification E-value
Superfamily beta-Roll 0.0000000693
Family Serralysin-like metalloprotease, C-terminal domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427738517|ref|YP_007058061.1|
Sequence length 2084
Comment Ca2+-binding protein, RTX toxin [Rivularia sp. PCC 7116]
Sequence
MFVVSAEAQRYLRKTAIELLCIFLLNYSNQTILKKILNKENMNNRITNILLIDSSVDSYE
FLLEGIVGEVETIVLDSKRDGIEQITEVFAKTSGVETVHIVSHGSPGSLYLGNSELNLSN
LEYYKPQLDNWCCQNLLIYGCNVAAGDAGEEFVEKLHCLTSANIAASKTKTGNAELGGNW
ELEVRVGKDFAVEKDISLIFEQHTLAEYSGVFDPNQNPVITTTNNTLNYTENALQIIDAE
ATITDIDSPNFNDGTLTVRFTSGNTENDRLSIRNQGTEATQINVDNTIVKYSDVEIGTFS
GGVITGELVVNLNENATPTAVQALLRAIAYQNVSDNPDTTERNLEFIVTDGQGGISEAIS
KTIIITPVNDAPIIDKTLLRVDENAEKGTVVGTLTATDPEGTTDFSDWQIRNNSKFDLDD
DGEGAFAINANTGEITVNDSDDLNYENRTYSYVDVSVSDGQDVSKFSSIRITLNDVKGTN
VNGTSENDKLYGTPEAEIILGKEGNDHIYGMGGSDTLDGGEGIDTVRESADADFRFSSSG
GEYNGQLYSYEANTRKNLGTDRLENIERLALTGGESNNKLDVQYFNGNANLSGKGGNDSL
TGGRGNDTLSGGTGNDTLDGGEGIDTVRETADTDFWLQDNLLNSSDTETKQTLGRNTLKN
IEKASLTGGQNDNFINAEKFTGNVNLSGKGGDDTLIGGYSNDILSGGEGNDSIDGGEGID
TVRETADVDFQLENVRLDDSQLKTTDSKTGSQLSIDQLKDIERVQLTGGESKNKLDASRF
SGNVHLSGKGGNDSLVGGSANDTLSGGEGSDTIDGGAGIDTLREAADVDFKLTDNQLAST
EVKTRNLVANDELRNIERVVLTAGESNNKIDASEFSGNVNLSGKGGRDTLIGGSGNDTLS
GGEGDDTLDGGEGIDNLRETADADFRFLSSTRGEYSGQLDSYEANTRKTLGRDRLDNIER
LSFTSGESNNILDLRKFSGNVNLSGKGGNDTLYGGSGNDTLSGGEGDDTLDGGEGIDNLR
ETADADFRFLSSTRGEYSGQLDSYEANTRKTLGRDRLDNIERLALTGGENRNKIDVANFN
GNVNISGKGGRDTLIGGSGNDILSGGEDYDTLDGGEGIDTLRETADANFRLTDGQLDSYD
VNSRQNLGRDRLNSIERASLTGGETNNYIDASEFSGNLNLSGKGGKDTLAGGSGNDNLNG
GTESDILGGGSGKDTLSGGTGSDTLDGGDGIDTLRETADADFRFLSSSRGEYSGYLEIIE
EKTRERDRDKLDDIERLSLTGGESDNRIDAQYFKGSVNLSGKGGNDSLIGSAGDDTLSGG
EGNDTIDGGKGTNTLRETADVDFRLEGNPFNNYQLTSYDSQTLQQLSTDGIRNIKLASLS
GGESDNRIDASQAYISVNFAGKGGSDTVIGGYFNDTLSGGEGNDTIDGGEGIDTLRETAD
TDFRIIGNRIESYDSNTRRNLDSDEFRNIERIFLTGGESDNNLEARDFEGNITLSGKGGD
DRLISGSGNDMLSGGDGDDTLDGGEGIDTLRETADVDFSLRNNNLYTYDVESGSTLDRNG
LRNIERASLTGGESNNELDAKYFDGNVNLSGKGGRDTLIGGSGNDILSGGEGDDTLDGGD
GIDTLRETADVDFKLSGTSYLYSYKVNTTTILDRDSLRNIERISLTGGESNNKIDASQSK
ISVSLAGKNGNDSLIGGFANDTLSGGEGYDTLDGGSGIDSLRETVNANFLLTDSNLSIFN
PETQRELGKDEIRNIERAILTGGNYSNIISASGFTGTTYLYGREGDDSLIGGSGTDHLNG
GEGDDTLDGGDGIDYIRETVDANFRLKDTLLEIKQANTNKYIGRDTLRNIERAVLSGGRS
NNVIDARYFDGSVNLYGRDGNDSLIGGKANDNLDGGQGDDTIDGGEGIDTIRETADANFR
LTDDYLDSNEANTGRNLGRDRLYNIERAALTGGDNNNTINASAYTGATFLYGKAGNDTLL
GGSGNDYIKAGSGDDFIDGGIGSDRLYGEGGKDTFVLSSVTGKDTIYDFEDGVDTLGLSA
GLNFSDLNIKASGNHTNIIQGNQTLATLIGIDSSLIDESDFTSV
Download sequence
Identical sequences K9RJQ1
gi|427738517|ref|YP_007058061.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]