SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427738528|ref|YP_007058072.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427738528|ref|YP_007058072.1|
Domain Number 1 Region: 28-323
Classification Level Classification E-value
Superfamily Pectin lyase-like 3.77e-33
Family Filamentous hemagglutinin FhaB, secretion domain 0.0067
Further Details:      
 
Domain Number 2 Region: 658-774
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000000487
Family P22 tailspike protein 0.074
Further Details:      
 
Domain Number 3 Region: 509-651
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000182
Family Filamentous hemagglutinin FhaB, secretion domain 0.057
Further Details:      
 
Domain Number 4 Region: 296-426
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000534
Family iota-carrageenase 0.051
Further Details:      
 
Weak hits

Sequence:  gi|427738528|ref|YP_007058072.1|
Domain Number - Region: 384-501
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00138
Family Filamentous hemagglutinin FhaB, secretion domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427738528|ref|YP_007058072.1|
Sequence length 1077
Comment filamentous hemagglutinin family domain-containing protein [Rivularia sp. PCC 7116]
Sequence
MQSNLKFWFLSLPLTTFLCFTGIKDKVSAQIIPDNTLGNDNSVVETITPQLQRIDGGVTR
GANLFHSFQEFNIGEGNTAYFSNPATIQNIFTRVTGNNPSQIFGRLGVLGNANLYFFNPN
GIIFGANTSLDIRGSFIASTASSLTFPESKKFSATNPEAPPLLVNNVSVPVGLQFEGIPG
TITSTADLQTGQDLKLAAGNLDLQNQLQATGDLTLEAADTINIKGNLDASSRFNLGKGGD
INLIAGGDIIVNPETSIVSRGKVGGDITLDSDGNISLTNSTIDNRSFNLIQEDTTPTGGN
ININADSVSINELSLLNTSTEGFANAGDVNINVNDLIEVNYSDIYTRVNADGVGNGGNIN
IAGDSVKIIDGSNLQSRSLGQGNSGNINITAKDEVKFAGIRSGFVSLATSEVINGAVGNA
GDINITVSNGSLNIDDGNLLLTENSGDGSAGNVNINAKKSVALNDGTILARVEFAENNSL
AIGNAGNINIETSNLQMKNAQLAISNDRRGNSGEVNIIADTLSLESSSINAGSTLENAGE
VNIKARGSVSLTNSQIFTSALLGENKGGNIVIDAQSLVMTDNSTIGGSKRRQSETQNTAG
SAGNINIKTNDFVTLDNNSNISASGFSGAGGNILIDTEKFSLQNGSQVTANVRGNQPAAS
LTINATESVEIIGFANFLNSQLSIDTNGIGDAGNLVINTGNLIIKDGGIVSSSAFVGKGG
NLEINATESVEVIGTIRNGIDISSLKTDAGRADGGNLKINTPQLKVADGARVSALVNGSG
NGGTININASESVQVIGTSKINDLIPSTITTGSNSISVEGNAGEINIVTPDLIVKDKANI
AVNSQGRGIGGNIQLVTDNLNLDNGLIDATTRSTIGGNINVRADDIITMRRDSQISTTAG
NEEFGGNGGNITINSPFIVAFPGNNQGNDITANAFTGNGGNINITTQALFGIEFRNQLTF
FNDITASSEFGIDGSVNIDTLEIDPTRGLNQLPQETVNAEVSQNCQASRGGAKIQFYDVG
TGGIPYSPNSLSNAEPFINENLIPLKPAPVSARKNQPQNNNISRKNSFINTLACQER
Download sequence
Identical sequences K9RHU5
WP_015121083.1.44015 gi|427738528|ref|YP_007058072.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]