SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427738533|ref|YP_007058077.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427738533|ref|YP_007058077.1|
Domain Number 1 Region: 185-193,250-383
Classification Level Classification E-value
Superfamily beta-Roll 0.00000000000000275
Family Serralysin-like metalloprotease, C-terminal domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427738533|ref|YP_007058077.1|
Sequence length 392
Comment hypothetical protein Riv7116_5133 [Rivularia sp. PCC 7116]
Sequence
MDEIQDLGILQDAEVETSGLFTAGGNVEDTLSFTLEQPTNIEINGFSLTPTSDTVNDAGL
FIPGSRVRFRIAEDANNNDVIDNGEVIAEPSQLPISTVTDPAVVFQEDLSAGSYLIELAP
IGTVASPLISPELPTYQLTIDPTPLSTDNGGNDTDNGTVDNSGNDTDNGTVGDGGSDTDN
GTVVDSGNDTDNGTVGDGGSDSDNVTIGDSRINTVTGSNQSESLFSSTNEALFGLGGDDR
IYNNNGISLQFGGDGNDELYGNSLPDFLAGGADNDLIFGNGGSDMLFGGEGDDTIYGSSS
AERFDGGEGNDILWLNGGEDIIVLRQGDGTDIINGFRLEQTQFELVDGLTFGNLSFEQSD
SFTNILAGDEVLATVKWATAESLNDASNFNVV
Download sequence
Identical sequences K9RHU9
gi|427738533|ref|YP_007058077.1| WP_015121088.1.44015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]