SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427738562|ref|YP_007058106.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427738562|ref|YP_007058106.1|
Domain Number 1 Region: 168-302
Classification Level Classification E-value
Superfamily beta-Roll 1.67e-16
Family Serralysin-like metalloprotease, C-terminal domain 0.0011
Further Details:      
 
Domain Number 2 Region: 346-449
Classification Level Classification E-value
Superfamily beta-Roll 0.00000000000000785
Family Serralysin-like metalloprotease, C-terminal domain 0.0035
Further Details:      
 
Domain Number 3 Region: 36-119
Classification Level Classification E-value
Superfamily beta-Roll 0.00000000484
Family Serralysin-like metalloprotease, C-terminal domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427738562|ref|YP_007058106.1|
Sequence length 555
Comment Ca2+-binding protein, RTX toxin [Rivularia sp. PCC 7116]
Sequence
MKTIIDESQLKSSVDESLLKSSVPSSLYTPNLSLFYNIIIGTPFNDYIPTTFLNDFVVAL
SGDDRILGSFGNDIIVGGTGKDTADYSNLGQAVTLEAAGVVNKGFFGRDQLYEIETIIGA
KGQANAIDGSTGQSRTTSFNVNLAKQSLIVNGIPGLGTAKFQVQNFVNVIGTSQGDTIFG
DNYNNVLDGRGGNDTVFGLGGNDTVRGGAGNDVIGGGNKGNIFISRFSDGNDIVEGGSGN
DSLIGGTGKDVLDGGSGFDTADYTHLGRAITLEAAGIVNKGFAGTDQILNIEKIVGAKGR
ANAIDGSTGKSTTTSFNVNLAKESLVVNGIPGIGSAKFQVQNFVDVTGTSQADSIVGNSK
NNILEGGRGNDNISGLAGKDTLIGVDSKSFNPGRYEVDILTGGTDADKFVLGNEKSAFYT
GGGGFFGLNDFAFITDFEAGEDKLQLKKSESYIFGRNFIAVSNYFKPYPLPYEAASDELL
TGGKTSLNNDLDSSVADSAVNDIIKNNGISSTLSLGAETQVAQNSLESSLFIPFPSFDIV
AVVADNYSYSDIHFV
Download sequence
Identical sequences K9RJU0
gi|427738562|ref|YP_007058106.1| WP_015121117.1.44015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]