SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427738568|ref|YP_007058112.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427738568|ref|YP_007058112.1|
Domain Number 1 Region: 90-405
Classification Level Classification E-value
Superfamily Pectin lyase-like 4.08e-44
Family Filamentous hemagglutinin FhaB, secretion domain 0.012
Further Details:      
 
Domain Number 2 Region: 403-566
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000000254
Family P22 tailspike protein 0.058
Further Details:      
 
Weak hits

Sequence:  gi|427738568|ref|YP_007058112.1|
Domain Number - Region: 642-815
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0471
Family Filamentous hemagglutinin FhaB, secretion domain 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427738568|ref|YP_007058112.1|
Sequence length 1098
Comment filamentous hemagglutinin family domain-containing protein [Rivularia sp. PCC 7116]
Sequence
MKNIFFIIIYESFFSPCPPASPAPPALSNQDGMRKLSNLNWCIFSIASLCAIVSSINKVS
AQVIRDETLPKNSEVKVEGNISTIEGGTKSNGNLFHSFKEFSVPTGNEAHFNNAADIQNI
ITRVTGKSISDIDGLIKANGTANLFLINPNGIVFGENAKLDIGGSFVGSTADSIKFDGDI
EFNAINPENKPLLTVNVPLGLQYAQNPGKIEFKGKGEPERKIPRVIEAKTGLEVPANKTL
ALLGGDVLLEGATLKASSGRIELGSVTGESLVSIAAIEKGFGFGFEKLANIGEKFGDIRL
SQNTAVDASGNGAGDIRVTSKNFTITDNSVVVSTQTGTEKSGSIVINAKESVNFDGINDT
FIPSGLYANNVSKNRTENTGNIRINAPQFIVNNRATIGANAWSAGNGGDIDIKTNDLRVE
GGGIVSAAVFGNGNGGNVNIDASNVQILGTSNDGKSFSELSVSAKKNSTGNTGNMNINTS
NLEVAGGALIFAGTSGEGNGGDMTINATESIKIIGRGGNENQFTSGLFVVANEEATGNSG
SLTINTNKMQVENFAFVSASNNGKGNAGDLQITTNELLIKDDASLISGVESENKLAGQLT
IKTGKLLIEGGSRVNAGATSSDKVNLDIDAQEIQVIGTGNNGKTPSQLSILIQDNLISNA
GELNIVTNTLLIKDGAFLFTGTSGKGNGGNLTINAEDIQVIGFGGNNPDNNNQPYFSGLF
ATAEKNSIGNAGKLNINTKRMLVEDRAFVSTSTNSNNGDGGDLNINANNLQVRNDSKVVS
ETNSKGTGGNLKITTNNLLVENGGKVSSGTSGAGNAGNLTIDSDAIKVKNDEAQITVESQ
GRGNAGVLTLNARSINLDNNALLNASTQSSDSSKEQATININSRDLILHRRSNIFTNAKG
EQVIGGNINIKTDFLIAGENSDISANSENFRGGNVRIDAQGIFGTEFRDRPSDSTSDITA
TGASPDLAGIVEIITPQSDPNNGLVELPTIPIYPEIADTCSTPSYAQSSFTITGAGSLPP
SPFKPLTGNLNRTSLVTLAGEIKPPVRRSRQAPKQKQEIKQIVDAQGWVRTKDGKIILVK
NATQNSNFLAMKNSAHCN
Download sequence
Identical sequences K9RHY3
WP_015121123.1.44015 gi|427738568|ref|YP_007058112.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]