SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427738599|ref|YP_007058143.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427738599|ref|YP_007058143.1|
Domain Number 1 Region: 2-196
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 9.62e-38
Family FAD/NAD-linked reductases, N-terminal and central domains 0.028
Further Details:      
 
Domain Number 2 Region: 152-319
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000414
Family FAD/NAD-linked reductases, N-terminal and central domains 0.011
Further Details:      
 
Domain Number 3 Region: 289-444
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000551
Family C-terminal domain of adrenodoxin reductase-like 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427738599|ref|YP_007058143.1|
Sequence length 535
Comment K+ transport protein [Rivularia sp. PCC 7116]
Sequence
MLDCIVIGAGPGGLVTTKELLEQGLSEVVCLEQAESVGGVFANTYDNLVLTSSCTYSMFS
DFWMGNGNQHKFWTKNEAVDYWKRYAKHFGVLGKIRFNSKVVAVTEQGNRGWQVQLLSGE
TLRSKRVALAIGNNSIPNYPQWKDSLTEVEFSHSQKYRNASNFVGKNVLVVGGGESASDI
ALEISGVAKNCWVSLRNSTGFVVPRKRGKRANDISTNRGIYGLPREYGHTLSKIISRQWS
SYKDPIEKTAVRLNEKVKSRNGLWGTYGTKTYALPKAIAHHGCKVVGEIIGVEDGGRTLL
AVDGETLHSVDAVVFCTGYQNYMSFLPEELKKTDPRSLYKHMFHSRYRDRIVWIGLARPG
FGSQFPIMEMQARLFSLICTGEKTLPAAVAMEKAASVDRQKYLQQFEHNAHRIRSLVDYH
IYMDELADLIGCKPPLWKYFFLHPRLWLRLVYGATQATQFRLRGPGQKETWAKEAIAKLP
VVQFNYFFLAGLRGRAIYSFKAIVKGMGLIREQRDFVKMSAIAKIQSAYLKYLRH
Download sequence
Identical sequences K9RJA4
gi|427738599|ref|YP_007058143.1| WP_015121154.1.44015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]