SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427738672|ref|YP_007058216.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427738672|ref|YP_007058216.1|
Domain Number 1 Region: 6-350
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 2.25e-71
Family beta-Lactamase/D-ala carboxypeptidase 0.0000513
Further Details:      
 
Domain Number 2 Region: 509-638
Classification Level Classification E-value
Superfamily beta-Roll 4.32e-27
Family Serralysin-like metalloprotease, C-terminal domain 0.00066
Further Details:      
 
Domain Number 3 Region: 435-502
Classification Level Classification E-value
Superfamily beta-Roll 0.000000392
Family Serralysin-like metalloprotease, C-terminal domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427738672|ref|YP_007058216.1|
Sequence length 639
Comment penicillin-binding protein, beta-lactamase class C [Rivularia sp. PCC 7116]
Sequence
MNNNISSDLAQQLQANIDSVVQSTKIPGVAVAVISPEENWYGASGVSNLETEKSMNPDDL
FKIGSISKTFTGATILKLVEEEKLSLQDTLDKWLPDSTIANIPNAKEITVEQLMNHTSGI
FSYTNNLKFATDELAVLNGADIDRSREAILENYVSGEDAYFAPGESFFYSNTNYLLLGML
IEATTGNSYQSEVNRLILEPLGLDNTYFVGDEIPDERFVRGYGDLLGEDGSLGADGIYED
TTDAFSSLASTLSDGGIVSNSKDVARFSDALFSGELIIPESLNKMLSWSNIDEAEVEVGS
QYGNGVYEEKTPWGENWGHDGGTFGYISKMRYFPETDTTITVFVNQLDPQAVILPTDSVF
SDVSKTLFGETNNITPEGFFDSLDSNFVDGLIDAIDGVDNKADLIALASNENTLAEFDYD
AVNEDKFFELIDNPLNQDEFNDLLNFLRYGDVVKEESDVMVGNKADNTLAGEDRNDTLAG
GLGDDLIFGQGGDDVLRGDLNNRSGGGNVGGNDTIYGGIGSDRIGGKAGNDLIFGDIGND
RIWGDAGDDTLTGGLGNDSLYGGTGNDVFILELNQGTDKIFDFKVDDDFIGIASLGISVE
DIDLSQQGKNAVIAVDGSDIAILQNLNFESLSVDNFAFV
Download sequence
Identical sequences K9RK37
WP_015121226.1.44015 gi|427738672|ref|YP_007058216.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]