SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427738729|ref|YP_007058273.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427738729|ref|YP_007058273.1|
Domain Number 1 Region: 2518-2862
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 4.07e-45
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.0000619
Further Details:      
 
Domain Number 2 Region: 680-978
Classification Level Classification E-value
Superfamily DNase I-like 1.7e-34
Family DNase I-like 0.012
Further Details:      
 
Domain Number 3 Region: 2878-3098
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 1.01e-30
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.0000903
Further Details:      
 
Domain Number 4 Region: 1000-1019,1073-1150,1182-1272,1426-1490
Classification Level Classification E-value
Superfamily 3-carboxy-cis,cis-mucoante lactonizing enzyme 4.71e-19
Family 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.051
Further Details:      
 
Domain Number 5 Region: 1428-1478,1593-1768,1797-1842
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.000000000000337
Family YVTN repeat 0.0055
Further Details:      
 
Domain Number 6 Region: 1114-1148,1479-1594
Classification Level Classification E-value
Superfamily beta-Roll 0.0000000000157
Family Serralysin-like metalloprotease, C-terminal domain 0.0026
Further Details:      
 
Weak hits

Sequence:  gi|427738729|ref|YP_007058273.1|
Domain Number - Region: 215-279
Classification Level Classification E-value
Superfamily Lamin A/C globular tail domain 0.00209
Family Lamin A/C globular tail domain 0.023
Further Details:      
 
Domain Number - Region: 2216-2533
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.00275
Family YVTN repeat 0.046
Further Details:      
 
Domain Number - Region: 1991-2030,2057-2158,2212-2235,2269-2312
Classification Level Classification E-value
Superfamily YWTD domain 0.011
Family YWTD domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427738729|ref|YP_007058273.1|
Sequence length 3325
Comment putative extracellular nuclease [Rivularia sp. PCC 7116]
Sequence
MANIAFDLRNSSSQNLTSFTNNSPTFSSAGDGFGKFQRGVSTSIPFSVLDDSAVGFPADN
LGIIPETNTDAFFGATDTENGDNTGAVNAVWEFDISGASNLSLSIDTGAMGDFEADDSFS
WTYQIDGGTVNTAFTGSADEADSFTYTLADGDTFTLDDPMKVDGTTLSNNLQTLTTPITG
TGSTLALTLTAQTNGGSEAFAFQNILIEGDTAPTPANLVISEIMYNPNSSEDDWEWVEVY
NAGGSTADLSGYVIDDGNNSFQTAANIASGSIAAGETAILYNVDDVAVADFEAAWGTGIN
LIGVTNWGAMGLNNGGDRVSLWSNFTDYSGDEATFANVIDTVEFDDDGTVWPSDNGSASI
YLTDLSADNNVGTNWALSTESGATPAGSGYMSFAAGGNSGGDVGSPGGTITNTPTPTPAK
IYEIQGESHTSPLVDQLVTTLGVVTAVDDDGFYLQDATGDDNDATSDAIFVFTDSNPTVE
VGNHVEVTGTVSEFFPGGESTGNLSTTQISGSPTVNVVYSVDALPAATIIGAGGRVPPSE
NIDDDAFASFEPETDGIDFFESIEGMRVTAQDAAAVAPTNRFGEIFTVVDNGNGATGISE
RGTLNISPDDFNPEKVQIDTDSDISGFDIPEVNVGAKLGDVTGVVGYSFGNFEIYPTEDF
TANVVDSTIEPETTAIEGNADKLTVASYNVLNLDPNDSDGDTDVADGRFDAIASQIVNNL
KTPDIIGLQEIQDNSGSGDDGVTSADQTLQDLVDAIAAAGGPTYSFIDNTFIGNNTSGGQ
PGGNIRTAFLYNTNRVDLVDGSVETIEGDGFAGSRLPLVAKFTFNGEEVSVVNNHFSSKG
GSSPILGVEQPFEARQEEVAVNGSLDERQAQSQAVKGYVDGILEENADANVVVLGDLNEF
EFVSPVETLADSLTNLTETVSEDERYSFIFQGNSQSLDHILVSDNLTDTAEFDIVHVNSE
FADTDEKASDHDPLVASLSFSKENMDKINLSQIGTYTSEDGAEIVAHDPTTQRLFVTTGD
TVEIIDISNPSNPTKFGEIDLSTIGTFVGGGSNSVAVYNGIVAVAVEANTAQDNGVVAFY
NTDGILQNSVEVGALPDMLTFTPDGMKVIVANEGEPNDDYTVDPEGSISIVDISGGVGSA
TVITAGFAGFNDDLETLKADGVRIFGERAGGTDATVAEDLEPEYIAVSPDGTKAFVTLQE
NNAVAVLDIASATVEAIKPLGFKDYNAEGNGIDASNRDDGINIQNWPVFGMYQPDAINSF
EVDGNTYYITANEGDARIRPDGDIEDADGNVITEEGDIFNEEERIKDVTLDPTAFPNAAE
LQEDENLGRLKITNTLGDTDGDGDFDELYSYGGRSFSIWNDKGELVFDSADAIAQITAEQ
VPELFNANGGDTEEFDERSDDKGAEPESVTVGMVQGKPYGFIGLERTGGVLVYDLSNPSE
PEFQQYITTEGDIAPEGLEFIAADESPNGKPMLAVANEVSNTTTLYEIFDNTFSGDDGDN
TITGNDTNDFIDAGAGNDTINPGTGNDIVNAGPGDDTIVGGQGDNQIDGGEGIDTVTYDG
NRTDFDIERIGDQIKVGSNTDTLTNVEFLEFNDGTIDTADIKSTSTDKINLSQIGTYTSE
DGAEIVAHDPTTQRLFVTTGDTVEIIDISNPSNPTKFGEIDLSTIGSFVGGGANSVAVYN
GIVAVAVEANTAQDNGVVAFYNTDGVLQNSIEVGALPDMLTFTPDGMKVIVANEGEPNDD
YTVDPEGSISIVDISGGVGSATVMTAGFAGFNDQKQALINKGVRIFGPNATVAQDLEPEY
IAVSADGSTAIVTLQENNAIAVVDIETATVADVLPLGVKDHSKGQPTLTQYEFSNLPVLG
TTATTNPEDSTQTTAGQDILLGGLSGLHYDGIAANGNLKFVTVPDRGPNGNSSDVDGDDA
NERPFALPDYQAQVVTFELNEATGAIENLRQIGLTRQDGTPITGLPNIPGVDEEPVDLFG
NLLGYDEFGADLEGVVINPADGSYWMVDEYRPAIYNFDFTGKLINRFVPEGTGDLGGQPA
GTFGSETLPAEYSSRRPNRGFEAVALDTDNGILYSFIQTPLANPDRDASDNSDVIRILGI
DPATGNPVSEYVYLLEDPAVRDGGRVDKIGDAVYVGDGKFKVIERDSAVGENAKKFIFEI
DLTGATNLLAADAPALMAGKTLEQHTADELVAQDINPVEKTKVTNLPSIGYQAGDKPEGL
TMLPDGRLAVLNDNDFGLLDNDIPVDGTVPINPNPTPVVLGIIDFPEGNQLDASNRDGEI
DIKNHPILGLYQPDAISSFEVDGKTYYITANEGDARDYDGFSEEARVGDDEIVLDPTAYP
DAANLKQDENLGRLKTTTTLGDYDGDGDVDQIFSYGGRSFSIWDGVGNLVFDSGDQIAEI
TASQTPEFFNANNGDPDDFDSRSDDKGAEPESVTVGMVDGKPYGFIGLERAGGGVLVYDL
SNPSAPVFNQYIRTEGDIAPEGLQFIAAEDSPNGKAMLAVANEVSNTTTLYDIAVSDFTL
QLLHTADQEGGIPALEDAPNFSAVLNALKNEDADGDGIVDYENTLTLSSGDAYIPGIFLD
ASEDESLADLLGKEGKGRSDIIIQNELGFQAIALGNHEFDLGTEFIASVIAPDEAYPGAN
FPYLSSNLDASTDANLAPLVTPDGQEASDIAGKIAGNTIVTVNGEKIGVVGATTPTLASI
SSPEGVTISPENPEDIAALAAEIQASVDSLLAANPDINKVVLISHMQQIAIEEQLAGLLK
NVDIIMAGGSNTLLSDSTDRLRDGDTSQGVYPIVKTDADGKPVAVVNTDGNYKYVGRLVV
DFDADGNIIPASIDPNISGAYATDEAGVAAVGGTPDPEIVAITDALSEVIADLEGNFFGV
TDTFLNGTRGSVRTEETNLGNLTADANLAIAKQTDSSVVISIKNGGGIRDNIGRVVTPAG
STEPEFLAPEANELAGKPEGGISEVDIKNTLRFNNGLTLLTASAEELLAIIEHGVAASGD
GETPGQFPQVSGLSFSFDESLPAGDRVQSLAVVDEDGEVIDVIAKDGELQGDASRTFRLV
TLSFLANDDDGDGFGGDGYPFPQGESANRVDLTLEDTDPRTGAATFAPDGSEQDALAEFL
AANFSEENPFSEEDVAPELDMRIQNLEFREDTVLGDIASTPIITQEVDGTTVEAIDLTGF
DAQPTVAVNYTITREAAFDNEVYFYAVDDINGSVNGVNVGDANYVEEALKQLVSPEFSTT
NGDIESGNVEFNAGSIVVPVIIADGTFAEALSGAAEVYFPYLGANSDGFDHIRFNDTTNT
FEFEDLANGGDQDFNDITITINSIA
Download sequence
Identical sequences K9RJP2
WP_015121283.1.44015 gi|427738729|ref|YP_007058273.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]