SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427738966|ref|YP_007058510.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427738966|ref|YP_007058510.1|
Domain Number 1 Region: 232-359
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000059
Family Nucleotide and nucleoside kinases 0.022
Further Details:      
 
Domain Number 2 Region: 38-169
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 0.000000000000817
Family HD domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427738966|ref|YP_007058510.1|
Sequence length 372
Comment hypothetical protein Riv7116_5594 [Rivularia sp. PCC 7116]
Sequence
MWTFPYCPNKGDFAINWRELENKFEWLRVLADCPQDARYHEEGDVLTHTKLVCEALIALP
QWQALPEIQRSMLFAGALLHDVAKPKATKIEDSGAISSKGHVLQGAKMAQEILWDLNVPF
QQREEIVSLVKYGSLPLWFWDKLNPQKAVIKASQIIRCDMLAMLAEADVRGRYCNDQNQL
FERIDFFREFCRENNCFSQPRLFPSAHSRFIYFQKENGNPDYHAYDDTRFQVVIMSGLPG
SGKDTWIQENLPEYKVISLDDLRREMGIKPGDNQGEVANAAKYLAKEYMRTGVSFVWNAT
NLNKQLRGMLIRLFAAYQADIRIVYLETSWSNLLKRNKTRTDKVPEKVLYRMKNRLEVPT
IIEAHRVDWIAS
Download sequence
Identical sequences K9RKF9
gi|427738966|ref|YP_007058510.1| WP_015121516.1.44015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]