SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427739027|ref|YP_007058571.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427739027|ref|YP_007058571.1|
Domain Number 1 Region: 34-291,329-345
Classification Level Classification E-value
Superfamily Pectin lyase-like 2.04e-33
Family Filamentous hemagglutinin FhaB, secretion domain 0.01
Further Details:      
 
Weak hits

Sequence:  gi|427739027|ref|YP_007058571.1|
Domain Number - Region: 906-990
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000565
Family P22 tailspike protein 0.087
Further Details:      
 
Domain Number - Region: 630-765
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0377
Family Filamentous hemagglutinin FhaB, secretion domain 0.065
Further Details:      
 
Domain Number - Region: 767-898
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0377
Family Filamentous hemagglutinin FhaB, secretion domain 0.044
Further Details:      
 
Domain Number - Region: 1013-1210
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0439
Family Filamentous hemagglutinin FhaB, secretion domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427739027|ref|YP_007058571.1|
Sequence length 1334
Comment filamentous hemagglutinin family domain-containing protein [Rivularia sp. PCC 7116]
Sequence
MLRIIKNQSCNRFSLSLSLLSVGMLFTPHQEAAFAQVSSDATLPNNSQINQQGSIYNITG
GTEAGNNLFHSFEKFSIPNGSEAYFKNNINIQNIFGRVTGKSISEINGLIRANGTANLFL
MNPNGIVFGENAQLNIGGSFTGTTAEAFKFSDGREFSAINLEDKPLLNVNVPLGLQYGKN
QNATITNSGNLTVNNGKNITLIGNSFENKGNLAANNGQISIAAIANQGFANLGVSGELLN
LVSQPIDTIDENTSNIGTVINRGSINTSNLQSGNGGKIIVLGEKIGLLENSLFNTSGNAG
GGEVIIGNSNTTATYIDQNAFLKADALDIGNGGNIAVFATESTRAYGRFSARGGLNHGNG
GFVSTTGINFLDVKDITVDTSSNNGLSGNWLLSTGNTFLGSGESFNPSSSDNFAIFQPAN
SSSVLDISTINKHLGTGNNITIAATKTGNQQGNIQADEINIKTQNNNPVLLTLQADNDIV
LSRGNIQSGNHHLGIVLQADSDKNSKGDIILGQGSDPSFEIDTKGGKFRASAASILLDGA
EITSKNTNLNNSREMAIATPGKAGLRNSGTIKQKADAGSSSDINIIANGSIVLRSSGIVK
QSSNASNAGDINIKADSFLINRGGIDNKTTRNSNGNAGNINVNVNSFILKLGGMTNETKG
NGNSGLINIKVDKFDLDTGVIQNITTGNGNANDIIVNANSVALKNGILLTSNQMTGDTGN
IVINATKDISIIDGALLGQTNGIGDGGNINIKADSLSLQGAINNNTTSNGNAGNINLQLN
DLFIKGGRISSETKGNGHSGFVKVEADALDFNGGDIQSVTTGDGNANDVTINTGTASFKN
SGLSTTTKGNGDAGNIFINADDQIFLGKDSFLNSGSSASGNSGEITVNSGSLILNDARIG
SNTDNENELHSIANAGNIDISADSILLQNDSTIASITFSQRNAGEIRLQADKITLRNSSN
IVTKTAEYSTGDAGKIIVETGSILFENELQFINDNPNKINSLSSNTEGKGNAGTIKITAD
KIILRNKGGIGIDTESEGDAGKLILKTSLLQLENSRIEDNAGIDSSSTGSGKAGELNITV
DKLVLDNSDIKAQTQSGQGGNINLNLTELLLLRSNSRISTEAGSLGGGSGGNITIDAPDG
FIVAVPNENSDITANAFDGKGGNIKITAAGIFGIKFREELTPETSDINASSELGIDGNVE
INTPDLTSDNELAELPSIPISSELAQGCYSPGYAQNQFFIVGRGGLPPKPEDIFTPSAVR
VEWVNPQSNNKNSLPNRNIDVESTTKKPKRIVEATGWILNEKGEIIFTADAPVIATRDNS
MQSNNCELVREIDK
Download sequence
Identical sequences K9RL69
WP_015121577.1.44015 gi|427739027|ref|YP_007058571.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]