SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427739030|ref|YP_007058574.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427739030|ref|YP_007058574.1|
Domain Number 1 Region: 438-552
Classification Level Classification E-value
Superfamily beta-Roll 0.00000000445
Family Serralysin-like metalloprotease, C-terminal domain 0.0017
Further Details:      
 
Weak hits

Sequence:  gi|427739030|ref|YP_007058574.1|
Domain Number - Region: 221-404
Classification Level Classification E-value
Superfamily Thermostable phytase (3-phytase) 0.000693
Family Thermostable phytase (3-phytase) 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427739030|ref|YP_007058574.1|
Sequence length 571
Comment hypothetical protein Riv7116_5659 [Rivularia sp. PCC 7116]
Sequence
MDNNLTASLIKDIKPGADSSNPGFLDDVNGNLLFTTFDTNSLNTQLWKTDGSEAGTVLVQ
DSGGNSFPPIDVVKVNDLIYFLQVSGFTNKSLIRTDATADGTFSIVNVSLRAPADISNLT
RLNETIFYTSFDSSDLFQSKLFKIENNTNQPVQVKQDISSGGGNVEDLIAVNNTLFFSAN
ASSIQNTPDKELWKSDGTDAGTVLVKNINPNDSSNPDLLADINGTLLFSAEDGTNGRELW
KSDGTDSGTVLIKDINPGNDSSISPTPFTAPTSNSGNKFADVNGTFYFVADDGTNGNELW
KSDGTEAGTVLVKDIVSGNEGSNPNNLINVNGTLFFSVNDGNSGVELWKSDGSESGTTLV
KDINPGENSSNPANLISLDGILYFTADDGSNGVELWKSDGTEAGTVLVDDINPGNASSNP
GDFTEFSGELYFNADDGVNGRELWGLTEGGTKPNQDLILGGDSDDVLVGKEQDNIIDGLK
GDDTLTGGSGRDKFVLSSEFGNDVITDFTLGEDEIINVTDRIVLTVASIGDAVNVAFSNT
GDILQLNLNGNEQADLENYLLNISSNQDLPY
Download sequence
Identical sequences K9RLQ3
gi|427739030|ref|YP_007058574.1| WP_015121580.1.44015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]