SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427739102|ref|YP_007058646.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427739102|ref|YP_007058646.1|
Domain Number 1 Region: 5-83,115-144
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000000091
Family P22 tailspike protein 0.087
Further Details:      
 
Weak hits

Sequence:  gi|427739102|ref|YP_007058646.1|
Domain Number - Region: 145-240
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0439
Family Filamentous hemagglutinin FhaB, secretion domain 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427739102|ref|YP_007058646.1|
Sequence length 393
Comment hypothetical protein Riv7116_5733 [Rivularia sp. PCC 7116]
Sequence
MKRWGSVTVNSQSIRLSGFNPNSFVPSILGGANVGIGDAGNLTINTRSLQIEDGARVDSS
TVNSGNAGSLTINAQDFIEVSGTVPGSINPSLIISSANILDESLQQFLGVPAIPSGDSGN
VTINTPVLKVSDGGEITVRNDGTGKGGILNINANSILLNSKGEITASTQSGAGGNIDLQL
KDGLILRNQSFISAESGGTGNGGNININSPVIAGLENSDIIANAVEGDGGNININTQGLF
GLQFQDKLTIQSDITASSEFGVNGTVEINNPAIDPSSSLTQLPSDVVDSSQKVASGCSVN
QSNSFTVVGKGGLAVNPQEAVAEVNAWNDLRDLNITNRNQQRNIQVENDSPKLIIEATGW
VVNKEGNIEFIAQSDNRDSWQKVSNCKGEVEKI
Download sequence
Identical sequences K9RLD4
WP_015121651.1.44015 gi|427739102|ref|YP_007058646.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]