SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427739158|ref|YP_007058702.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427739158|ref|YP_007058702.1|
Domain Number 1 Region: 346-540
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 2.24e-49
Family Ppx associated domain 0.0017
Further Details:      
 
Domain Number 2 Region: 150-331
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 4.54e-43
Family Ppx/GppA phosphatase 0.0011
Further Details:      
 
Domain Number 3 Region: 23-146
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 1.88e-35
Family Ppx/GppA phosphatase 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427739158|ref|YP_007058702.1|
Sequence length 544
Comment exopolyphosphatase [Rivularia sp. PCC 7116]
Sequence
MVNSTMITAENVPIPNFEPERIVAAIDLGTNSVHMVIVRIEPSLPSFSIVGTEKETVRLG
DRDVETGNLKPKIMERTIIALERFQEIARTLNAQAIIAVATSAVREAPNGRDFLYRINQE
LNLDVDLISGQEEARRIYLGVLSGMEFNNEPHTIIDIGGGSTELILGDSHEERCLNSTKV
GAVRLTSELITTDPISDREFNYLKAYARGMLERAVEEVLSNVNFGETIRLVGTSGTIETL
ANIHAKQVSDSTPSTLNGYSFSLKDLQEMVSNLRKMTNSERAEIPGMSEKRSEVILAGAV
ILQEAMTLLGVDSITTCERALREGLIVNWMLAHDFIDNRLRFQSTIRQRSVFKIAKKYKV
DLRYSERIATLALSLFDQTKGYLHEWGNQERFLLWAASELHNCGHYISHSSHHKHSYYLI
RNSGLLGYNETEIEIIANLARYHRKSQPKKKHDNYQNLATKYQRLIVEQLSPMLRLATSL
DRRQIGAISKIECDYSKDNKELHLKLFPSNKDDDCAIELWSFSYSKLVFEEQFGVKLVAS
LETD
Download sequence
Identical sequences K9RJL8
gi|427739158|ref|YP_007058702.1| WP_015121707.1.44015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]