SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427739340|ref|YP_007058884.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427739340|ref|YP_007058884.1|
Domain Number 1 Region: 449-793,824-908
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 1.5e-81
Family Alkaline phosphatase 0.00069
Further Details:      
 
Domain Number 2 Region: 6-436
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 2.83e-72
Family Alkaline phosphatase 0.001
Further Details:      
 
Domain Number 3 Region: 928-1075
Classification Level Classification E-value
Superfamily beta-Roll 2.22e-16
Family Serralysin-like metalloprotease, C-terminal domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427739340|ref|YP_007058884.1|
Sequence length 1087
Comment alkaline phosphatase [Rivularia sp. PCC 7116]
Sequence
MTSGNHVIFVHPDGTSPSHYAIARFVQEGPDGRLNWDKLDNAGVYLGHMEDQLGATSNGG
AVTHATGAKVYAESFGLEEDGSEIVPLSGNVGKTIVQEAVDAGKVTALVQSGAIYEPGTA
AFVAQVGETIDEEGNRTPPRGRTGDISKQVIESGVNFILGGGEVTLLPEGTKGFHGSAEE
LDELGSRLQRPDENLIELAKNNGYTVVYTEQELNDLLDPSKYPEPPQKVLGVFAPIHTFN
DRPEEVLEERGLPLYLETAPTIAEMLEVTQQLMEQHPNFDNGSIAIVEEEATDNFGNNNN
ASGTLEAMIRSDAAIGEALEFVDKYPNTLVITAADSDAGGLEVRDPRELGEPVGTINQNP
TTEPRPVPLDGVDGADTLPFTAAPDANGDVFNFGIGWVGTPDFPGSIVSKASGLNADKLP
STVDNTGIYELMYETLFDTELESRVPAPTPAPEATKDTGNVIFIHPDGTSPSHFMALRDI
DQGPDGRLNWDKMSNAGVYLGHMEDRLTGTSNGGAVTHANGVKVFNESFGLDKNNNQITP
ASGKTGFTILEEAIAAGKATALIQSGDLGEPGTAAFAAATTNRDGDDIRARDKAAEIIEQ
VIRSGTDVIMGGGELYMLPIGTTGFHVTPELDASETRPERRPSINLIELAESLGYTVVYT
EDQMNEAVNSDTPPEKLLGVFSADDTFDDRTEEELGLNTDTPFPLYVETAPTVAEMLDAS
LKIIEKDPDGFFAVVEEEGTDNFGNNNNASGTIEAMRRADAAIGEAIDYIDNQDPNTLLV
TAADSDGGGLEVFQFKPYDRPEGNFDEENPELSSQPEVPFITVNPTTERDTVNYLDGVDG
STASEENPWVPFSAKDSLDGEMGDFGIAWVGTPDVPGSIVSKTYGLNADKLPSTVDNTGI
YDIMYETLFGMTPQEAAEAAQETKLVSGTAEDDILVAGIDFKGTRNSVFTGAGDDEIDLA
FGGSNNRVDAGSGDDVIYLGNQNRVLGGAGDDKFFASGGDNIISGGTGSDQFWIVAGEIA
EAANTIVDFEAGTDVIGILGSASLGIDVSTLELTEMDGSTKVAFGGNTLAMLNGVTGLDV
NESVVFG
Download sequence
Identical sequences K9RMP9
gi|427739340|ref|YP_007058884.1| WP_015121889.1.44015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]