SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427739341|ref|YP_007058885.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427739341|ref|YP_007058885.1|
Domain Number 1 Region: 2-44,183-258,288-513,567-624
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 1.21e-64
Family Alkaline phosphatase 0.00034
Further Details:      
 
Domain Number 2 Region: 646-776
Classification Level Classification E-value
Superfamily beta-Roll 0.0000000000000301
Family Serralysin-like metalloprotease, C-terminal domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427739341|ref|YP_007058885.1|
Sequence length 815
Comment alkaline phosphatase [Rivularia sp. PCC 7116]
Sequence
MAKNVILMIGDGMGWEMARAAAIQKQITQGKTGATLTDFYTEGKGTGLSFQELDKYAIAT
TSGTYIDGDKSNSALKGDTLERETGVAVVREGFEQESLPGENADGEFEPAQVIGFFPELR
EGSIAPILGEFDPNFDERPIFAENEDGELVQVGGFLNAYDTTKGRDLPWLKDEDPDYPKN
LFPDSANTATTLYSGVKSYSGAIGVDIYEDDIQTIGEKARELGKSFGVVSSVPFNHATPG
SALGHVSQRNKLTETSRVTNNKVALDENGVPLHEEHGDGSHEGEPVFELDENGNKIPIED
DNILFQILNESQPELILAGGHPDGRGDERYMDLETLEKLRNGETVYTFTERGENAAQTLA
EVASEIDVEQGEKLFGLYGARGQGGNLPWSTANGDYSNTGLSSRLDAVRPLEEGETDEQF
IASEQDANPTLAQLTTAALDVLGDDEDGFWVSIEGGDIDWAAHDNNLDNMIGATLDFADS
VEVVQDWIEENGGYEENLLIVTADHDHYLTLNEDFPELLREFGAEALTTAVDDNGNVLAT
EVDQAGVALEEPRKVDNLDPDASGHYWGSNPDVKVGWSHHTTIPVPVYYQGAGSEFLDDS
VGKGFEQYGFDVPGVEGLIDQVHIAQAQFAAFENKNTPDTPSSGSGNNAPTLVSGTVEGD
TLIAGIDFKGTGDTVFAGAGDDEIDLAFSGEGKNRVDAGSGNDVIYLSSQNRVLGGGGDD
KFFATGGGNIISGGEGADQFWIVTGEIAEAANIIVDFEAGTDVIGILGSASLGIDASTLE
LTEMDGSTKVAFGENTLAMLNGVTGLDVGESVVFA
Download sequence
Identical sequences K9RLK3
WP_015121890.1.44015 gi|427739341|ref|YP_007058885.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]