SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427739657|ref|YP_007059201.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427739657|ref|YP_007059201.1|
Domain Number 1 Region: 823-939
Classification Level Classification E-value
Superfamily CalX-like 1.44e-19
Family CalX-beta domain 0.0023
Further Details:      
 
Domain Number 2 Region: 3-244
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.37e-18
Family Prokaryotic proteases 0.0024
Further Details:      
 
Domain Number 3 Region: 945-1078
Classification Level Classification E-value
Superfamily CalX-like 2.88e-17
Family CalX-beta domain 0.0029
Further Details:      
 
Domain Number 4 Region: 436-590
Classification Level Classification E-value
Superfamily vWA-like 4.04e-17
Family Integrin A (or I) domain 0.016
Further Details:      
 
Domain Number 5 Region: 1165-1261
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000257
Family Cadherin 0.0018
Further Details:      
 
Domain Number 6 Region: 1059-1160
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000055
Family Cadherin 0.011
Further Details:      
 
Domain Number 7 Region: 136-166,246-320
Classification Level Classification E-value
Superfamily beta-Roll 0.0000235
Family Serralysin-like metalloprotease, C-terminal domain 0.002
Further Details:      
 
Weak hits

Sequence:  gi|427739657|ref|YP_007059201.1|
Domain Number - Region: 710-848
Classification Level Classification E-value
Superfamily beta-Roll 0.000107
Family Serralysin-like metalloprotease, C-terminal domain 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427739657|ref|YP_007059201.1|
Sequence length 1606
Comment V8-like Glu-specific endopeptidase [Rivularia sp. PCC 7116]
Sequence
MSVIGPDSRQVITSFGTFPISTVTTVDIQTSAGSFVGSGITIAPNHVLTAGHNPYNASNN
TIATSLRTTTSANEDALRTRIIGFSSDPPANVTNVNFVDNYNVTGNPGDDIALFTTSDAP
IAASDVIGLIAFVDPATTTGLTIDTAGYPGDNVSGNIPGNTGVFGRDLVRSPGAAESPGN
IVFTSNGRFFYSQDVDTAGGQSGSGVWHTLDGDPNPRVLGIHAYGSSTNNSGVLITTDIY
DEIIDQIETDSGTTNANDLPENAIIGGTANDDIFGSYRRERIIGNDGNDRLFGGGANDRL
EGGDGVDQALFSEIFTNYDFTITDPLLPAFQFIHARGSQSDATDTTKDIEFGVFEFVDAD
ENGTDDDGNLFFVPLQVDPDDNTKLKDGALITPEEDILDDEGNKIGTITVESPAWMFDGD
VNYTLTLGSEQGLLYNFAYIFDSSGSMSGTRIVEAKAAYQELTQSLIDDGIAANSEFAVV
DFDSSASLFAPLDAPTTISTINGLVAGGLTNFNSALVEAQNFFTSRNNNATNIAYFLSDG
FNNGPDFSSSAAQLQQLAEVRAFGIGNPSLSELNIVDSDDAVVLSDPADLITEFNAATID
KNIIERIDVKLAGTVVDTITPDQLIEDTLGLKFEGTIDGLEVTRTAENDVTFDVVFNDGT
PTASLDYKITTGQEQVTQQTDNGTKQIITFSVNQTDFVESTQSQSISQENNQSNLENTVA
SQPVIREINANDLDNTIQVSDGQNTIFGNGGNDRFILLGGVNLVDGGVGIDTVEINKTQT
DAGGVSKNGNIVNIGTDNTLLNVEFIQFSDVRLAVDTLTVTPTLSLANQGISLAEGNTGS
TTATFTVNLSSTTTEDVVIDFATRSDNADAGTDFVENTGQLTIAAGQTSGDITLEILGDT
DVEGDESVSLDLSVVSGGTFANGATTATAGVNIIDDDSVISIPITGGDPTVVEGDSDAPS
TLTLTLDRFGGLNGTDTIKVEIIEKGDNPAQASDFVDGFSSSEVTFAAGEDTKTIDIAIN
PDREIEGDETFGVKLTSVSGTALVPSEDLIFTILNDDANTPPTITSNPTFQVAENTTTVG
TITANDADGNDLSFSITGGADQGLFSINDSGELSFINAPDFETAADADADNNYQVQIAVS
DGAENVAQDLTITVENVNETPTVDDATFTVDENSTSGTEVGIITATDPEKEALTFAISSG
NLDPDNDSNLAFAIDPSTGTITVNDKDDLDFEVTPTFNLEVTATDAGDLTDTANITVNLN
DVAPAQFETESNNGIFTLNGGDSTNVKFTLSNNNTENVNEVGVFVVNNENGNVDGNAPGS
DGYLKAALQRSQIIFSAISDRPSGFDLGDIERVIEVDSDAHLGFYLVSNGTTDTALAELA
ANGTTNLPIFFSDSSNLQVSDLVAESFNLNWSDEAGNSDFTNLDLTVQLTQDAPASATEL
QGNLQNELIDLSNESGQVSVSVEVHREAAFDNLIGFYQVLDSKGGIDTNGDGVIDFNPGD
AGYEEAALTNRITSLDLLQTDEQQTSSFDGTFDGGNILASFMVVDGTVDEAINNNAEVYF
SFLGANSDGVDHIRLLGDNTFGYEDLAGGGDFDYNDMIVKVDFPTV
Download sequence
Identical sequences K9RMX4
gi|427739657|ref|YP_007059201.1| WP_015122203.1.44015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]