SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427739665|ref|YP_007059209.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427739665|ref|YP_007059209.1|
Domain Number 1 Region: 14-275,337-357
Classification Level Classification E-value
Superfamily Pectin lyase-like 4.71e-26
Family Filamentous hemagglutinin FhaB, secretion domain 0.0078
Further Details:      
 
Domain Number 2 Region: 861-974
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000000127
Family Filamentous hemagglutinin FhaB, secretion domain 0.081
Further Details:      
 
Domain Number 3 Region: 659-806
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000377
Family P22 tailspike protein 0.061
Further Details:      
 
Weak hits

Sequence:  gi|427739665|ref|YP_007059209.1|
Domain Number - Region: 424-558
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000148
Family Filamentous hemagglutinin FhaB, secretion domain 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427739665|ref|YP_007059209.1|
Sequence length 1284
Comment filamentous hemagglutinin family domain-containing protein [Rivularia sp. PCC 7116]
Sequence
MRICISSIILLFTFPCFSVKAQLIPDNSLGKENSTVNPSMERDLIEGGAIRNNNLFHSFK
EFNVNPSQKVYFSNPDSITNILTRVTGNNASKILGTLGVDGNANLFLINPKGIIFGENAF
LDIAGSLSATTAESIFIDNYEFSAVNLNETPLLKISLTPGLQYGKINPQSEIENRGVLKV
GEKQNLTLLGGRVFHQDTGSLIAPGGKVEVSGSDINLKGTVDTRGSNGEVGTLLIDPKNI
LIEENGNLSGDDISQTLAVNNVVLQANNDITVDDDITGIGTNNLTLEAGRSLTIGENRNI
FLTGGSFNAKINDENALPSERDAGIAEFKMNPQSSIITNGGDVNVVSGSFANNSQINTLS
AAILSYKINGTSGNINLSAIGDIATGRLISGILNPDDDSSLNAGDININSTNGDILTTDF
IFANSLIKAGNITLKAENNINLTAQQAVETGNISSIGGRVAGSINLDGENILSQNVRTLN
GILGNGIGNDINVNTKSLTVENGSIIALTFGESNGGNLFINADEEMILRQSSVATNADGG
SSGDAGNLTINTKRLTVQRIPSLPSPFGVGIGTRTDTNTTGNSGDLTINATESIEIIGDR
PGSFVPQANQVVNSLLRGDDRTGITTSAEGSGMSGKLIIDTSRLIVRDNAAIVTAPFFGG
GGDLNISAKEIFLTGEAGIGTGNLFGENAGDLKINAEKVILLNGANIGTASFEQGNAGNL
ELSVAQLSISNGSTINSATIGEGNGGNLIIKDAQLIEVIGTSEDGSFPSNISASSLGSGN
SGNLNITTDKLNVRDGGEITTATDINGIGGNIDINTRTLEINDGRINASTTTPQKGGNIN
INASESIEVIGGGFDKLQENIIIPAFDGNKNSLTLNNFDNGIVTASQGEGDSGNILINTP
NFKASNGGLIATTTLNQGAGGDITINASDILEIDNSLLGTGTFTTENSGNIALTARQLIA
KGGAQILTTTFDAGKAGNLNVNISDSIDLIDPSEQGFTSGLFATSFQNASGDGGNITVKT
GNFNIVDRAAVSVSGEGVGNAGNIDIEALKLFLDNSSITAQSVSGEGGNITLTIADLLLL
RNNSTISTRAGTENSGGGNGGNITINGGLVVAAPNENSDINANAFQGNGGNIDITTPGIF
GIQFREQTTPQSDITASSEFGIDGDFDLNLQELDITSGLVELPENLTDAADRISAGCPTD
EEARFVTSGRGGIPQNPKQTLQNEVVLQDLRNIASTPSTPSTLSSPSQIKEATGWIVNKD
GDIEFIADNRIIKQTTFKKDSCQK
Download sequence
Identical sequences K9RNI5
gi|427739665|ref|YP_007059209.1| WP_015122211.1.44015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]