SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427739667|ref|YP_007059211.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427739667|ref|YP_007059211.1|
Domain Number 1 Region: 1414-1574
Classification Level Classification E-value
Superfamily beta-Roll 6.15e-17
Family Serralysin-like metalloprotease, C-terminal domain 0.0015
Further Details:      
 
Domain Number 2 Region: 99-178
Classification Level Classification E-value
Superfamily CalX-like 0.0000000641
Family CalX-beta domain 0.013
Further Details:      
 
Domain Number 3 Region: 291-410
Classification Level Classification E-value
Superfamily CalX-like 0.00000471
Family CalX-beta domain 0.013
Further Details:      
 
Domain Number 4 Region: 447-550
Classification Level Classification E-value
Superfamily CalX-like 0.0000131
Family CalX-beta domain 0.012
Further Details:      
 
Domain Number 5 Region: 692-822
Classification Level Classification E-value
Superfamily CalX-like 0.0000183
Family CalX-beta domain 0.015
Further Details:      
 
Domain Number 6 Region: 158-312
Classification Level Classification E-value
Superfamily CalX-like 0.0000314
Family CalX-beta domain 0.018
Further Details:      
 
Weak hits

Sequence:  gi|427739667|ref|YP_007059211.1|
Domain Number - Region: 952-1082
Classification Level Classification E-value
Superfamily CalX-like 0.000327
Family CalX-beta domain 0.021
Further Details:      
 
Domain Number - Region: 1293-1420
Classification Level Classification E-value
Superfamily CalX-like 0.000432
Family CalX-beta domain 0.026
Further Details:      
 
Domain Number - Region: 828-951
Classification Level Classification E-value
Superfamily CalX-like 0.0011
Family CalX-beta domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427739667|ref|YP_007059211.1|
Sequence length 1585
Comment hypothetical protein Riv7116_6321 [Rivularia sp. PCC 7116]
Sequence
MSQDSNLPVNSIPLIFGEVFSYVELPVVNFSVDRTVIVEGGEAQLITFNLSEPAPAGGLA
IKLRIDDPDGEPGDTDNALELFSNVTDSNNRVENGIFVANITIASGATEATIGIKALTDN
KVEGDETYSLTLLDNDNYIVDSASTTITTTIEDFMKPTVSLKIESETVVEDGQAKLIFTL
SEPAPNGGLVVNFNVEDSDPGFDEFIFNPEASSNIVEFKNLFQEGDTVAPQIITIAEGAT
EAILVQDIPDDGILESPETLTYTLDMGEGYKIDSEDNAASFTLVDKSNELPIVSLSPEIL
IATEGNSLVRNITLDRPVPEGGLTVNLVVTQNTESTIGELNINQEASTGITDSNGLIVDG
VALGVTVTLAEGITEALLVADTVADDIPETDEIITLSLADGEDYRANPDQNNLFTVFTDR
TVVTLTTDRVNVAEGDTFAWNFSLNQPAPEGGLTLSLPITLNNDPAPGDVIYNVEGSTNI
EDFGFITENDVSIGFTLTIPEGETVATLVSQAVVDDVAEFDEIFTTVLADGNDYVANPVS
NQVVTTIAEDGVAPPSSAPVVSITPSALISTEGDTFAWDFSLDKPVPSGGLTLSLPITQN
NDPAPGDVIYNVEGSTGITDFDFIVEDDISIGFSVTLAEGITQATLVSETVDDDDDLDDS
ADEIFTTVLADGVDYRANPDSNEVVTVLTREPVVSFTPEQVNVAEGDTFAWNFSLNQPAP
EGGLTLSLPITFNNDPEPGDVDYNVEGSTNITDFSFLVVDNVSLGFNVTIAEGATEATLV
SQAVADDLEEIDEIFTTILADGANYRANPVSREVVTTIVEQDSSSSTPVVSVTAEPTIFT
ENGGMGSFVITLSQPAPEEGLKIKFEAVDQDGMQGDSEVALENISDIEIITEGDSPSFIV
VEPGATEAKLMFTGIPDGVAEGEELSGFTILEGEGYTIDSNQSSANIIVTDLPIVSLNTE
PTNVNEGEQLKFNFEFSEVAPTGGLTVNLDLVEDTDPLPGDITYFVEGSENITDFELLVN
ESTGLIDGATVTIAEGATSATLLNDIIADNNTEGPESVKFGLASGDYSIDSDENAASFTI
VDTSVGGKANVHNAVVNPSFEIPQLPENQFTQTSLGEFIPGWKVFDPDALIGENITDVGA
YNPIPNVFASEAPEGENTAYAYSQAPIGSGIFGLTQTLDTQLKANTKYSLQVEVGNAAEN
NPDDGFNYEGFPGYRVELLAGGKVLARDDNSLSIAEGVFETSTVNFTATETEAFLGQDLG
IRLVNLLADSGEDVEFDNVKLFAETVEPVLTTLSLNAQPTNVNEGEQLKFNFELTEAAPT
GGLTVNLDLVEDTDPLPGDITYFVEGSENITDFELLVNESTGLIDGATVTIAEGAKSATL
LNDIIADNNTEGPESVKFGLASGDYSIDSNDNAASFTIVDTSVANEISGTTQDDNLYGTN
AAEIISGVRGDDNISGNGGGDTLIGGRGDDDIYGSFEADKISGGRGDDYIFGNGGNDLID
SGMGFDTVFLGAGEATVILDKGAGFDTIFNFQLGATKLEVSSLDNLNFTDGDSGTEIFQE
GDKLAVVAGQSANTFSSNQDMIFAV
Download sequence
Identical sequences K9RMY2
gi|427739667|ref|YP_007059211.1| WP_015122213.1.44015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]