SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427739694|ref|YP_007059238.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427739694|ref|YP_007059238.1|
Domain Number 1 Region: 61-330
Classification Level Classification E-value
Superfamily Pectin lyase-like 6.59e-42
Family Filamentous hemagglutinin FhaB, secretion domain 0.0064
Further Details:      
 
Domain Number 2 Region: 519-672
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000000286
Family Filamentous hemagglutinin FhaB, secretion domain 0.079
Further Details:      
 
Domain Number 3 Region: 673-773
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000173
Family Filamentous hemagglutinin FhaB, secretion domain 0.05
Further Details:      
 
Domain Number 4 Region: 334-438
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000195
Family P22 tailspike protein 0.065
Further Details:      
 
Weak hits

Sequence:  gi|427739694|ref|YP_007059238.1|
Domain Number - Region: 453-524
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00471
Family Filamentous hemagglutinin FhaB, secretion domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427739694|ref|YP_007059238.1|
Sequence length 1101
Comment filamentous hemagglutinin family domain-containing protein [Rivularia sp. PCC 7116]
Sequence
MNLSCRYKKQLSYITCLLLLFPSFTAKSVNAQLIRDRSLGVESSKVKSSVDRDLIEGGAI
RDNNLFHSFQEFNVNPNQKVYFSNPDNITNILTRVTGNNISRILGTLGVDGNANLFLINP
NGIVFGENAFLDIKGSFVASSGNGIVFDNYNFNTLNPKSPPLLTINLPLGIQLGSNPGEI
EVQGKGHYLTTAPPFSLQLERSDRSTGLRVNPGNTLALIGGNVNLSGGVLTAESGKIELA
AVNEGVVGINNNIRGWEFDYSRVENFGDIQLIEKSLADVSGVGSGFVEVRAQNLRMSDGS
VLWTQNLGDAVSGDIIVNVGDSLLVEGTTPDAAIRTGIFSEALGGNGGNVKVDAKKVTVL
AGGSIAAYTYGKYSGGNVDINASESILVDGISTLNPVIISAIAASNFSEGKAGINTVSTK
ELTISNGGMIVSATLGSGEPGLVKVKANDILLDGRSPITFSGGGLITNSIGEETSAADLV
VDTATLRLENGGIVSSSTQSSSDAGNITINATEFVEIKGRGLANRPSVVTSASRPLDEAT
RDFLGLFPDFVAGNSGSVSINTPKLRISDGGLINLVSEGLGKSGRVEVNADSIILNNEGG
ITIETNDDDAGNIQLNTNILQINDGIINASTSGSGEGGDINIDATESVEVNGGGFEKLQQ
NVINPPLNNQKLTLNSFDNGIVTASEGEGASGNILINTPNFTASDGGLVATTTLTQGSGG
DITINAADTLKLDNSLLGTGTFTPLDSGNVNLTARQFTAIGGAQVITNTFAQGRAGNLTV
NVSESIDLIDPSAQGFVSGLFATSSQTASGRGKPLRCGGSLRCSKWRNPKGGDIKVTTKD
FNIVDGAGVSVSGEGVGDSGNIDIEAVKLFLENSSITAQSVSGEGGNINLSILESLILRN
NSTISTQAGTQNSGGGNGGNITINGGLVVAVPEENSDINANAFQGDGGNILINTPGLFGI
QFRNQTTPQSDITASSQFGIDGDFNLNLQELDITSGLIELPENLTNAADRIAAGCPTDEE
ARFVTSGRGGIPQNPKQVLPNEIVLQDLRTFTSSPSSPSSPSTPSQIKEATRWIVNKDGG
IEFVADNTQVQQNSKNCQPVK
Download sequence
Identical sequences K9RMC7
gi|427739694|ref|YP_007059238.1| WP_015122240.1.44015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]