SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427739729|ref|YP_007059273.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|427739729|ref|YP_007059273.1|
Domain Number - Region: 114-150
Classification Level Classification E-value
Superfamily AF1531-like 0.000124
Family AF1531-like 0.012
Further Details:      
 
Domain Number - Region: 11-37
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 0.000706
Family Intein (protein splicing domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427739729|ref|YP_007059273.1|
Sequence length 455
Comment hypothetical protein Riv7116_6385 [Rivularia sp. PCC 7116]
Sequence
MVKIISRKVLKTENVYDIGLEGDHNFIIKDGLIASNCFNKSHSTAYGYVTYQTAYLKANY
PLEYMAALLTANSGDKDKVQKYIATCLNMGIQIESPDINSSEVDFTPANDKILFGLSAIR
NVGENARNCVLEAREEGAFTSLADFCDRVDLGTVNRRALQSLIYCGAFDKINDNRNQLIE
DLEFVYDWAQSRARDRASGQGNLFDLLGGAWSGGANTSNMPGNVILSPPKAKEVPDFPPQ
EKLRMEKELLGFYVSDHPLKSIGKSMQILSPINMTQLKNQREEAKVCVVVMLNNVKKVIT
KKGDPMAILQIEDLTTAGEAVVFPKTYDRINEILLVDAKLIIWGKVDKKDDQSQLIVDDA
EPVENIELIVIEMTPQQATTIEEHHRLRTVLKDLKEKSGEKEKGKIPVIGIIQAENSRQL
VRFGRQYWVQDSRSAIMALHNGRFNARIQPLSATT
Download sequence
Identical sequences K9RMG5
gi|427739729|ref|YP_007059273.1| WP_015122275.1.44015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]