SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427739744|ref|YP_007059288.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|427739744|ref|YP_007059288.1|
Domain Number - Region: 346-405
Classification Level Classification E-value
Superfamily TolA/TonB C-terminal domain 0.0049
Family TonB 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427739744|ref|YP_007059288.1|
Sequence length 586
Comment Gram-negative bacterial tonB protein [Rivularia sp. PCC 7116]
Sequence
MSYVSVLKNIPEFLSQPAGIAAIASVGIHGAIAFILPLMPVDSKPKEKASPASVGIMELS
EAEQNRLPQSRGPQISALPRVPSQPGIPLPNFATQPTPLARIPGNPDSTKVILPPLPRSS
GNPSLSALPQPKSLPILPQPNFKVDSSFNAKAKSGGSSYRRYNQNFKLGNPTPLVSRRNR
SSRKSAASVPNNIPPIQSAQLPAGIARIPAPPPLPPMGNPGISNGNSVAINSQISPNNNT
SVNQPVRVSPEDFIAPTNRNIPKPGDKLTFAGQNVQQWGQQQSGNRRILLPNQPSGNTTG
ITAPQNSKTPTTNTTTLALARQFNEVKQRYPNFETKEPISDVIKTKPGKEGKVEGTLVID
SDGKVDYLKYVDRSVASKLNKETRNYIRNYFKKNPIRKNGKAKVYAFTLDFKSDAANSSV
EFSKPKDKLIDRLRDAKDKPVQIDAKPSQKKPENVSRSSAPVKIDVKPSPGAVVVPTQTS
TPVKLKQPVEIRTRKPASPSASKDKLPVEIRLRNQEVPKVPSKPKPQARVNTTTNKPTPQ
VTSKPSLANRLRNIKKDSDENSEKDSDSKKLIQRLRKIQERRENSN
Download sequence
Identical sequences K9RMI1
WP_015122290.1.44015 gi|427739744|ref|YP_007059288.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]