SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427739918|ref|YP_007059462.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427739918|ref|YP_007059462.1|
Domain Number 1 Region: 2191-2318
Classification Level Classification E-value
Superfamily beta-Roll 4.71e-24
Family Serralysin-like metalloprotease, C-terminal domain 0.00094
Further Details:      
 
Domain Number 2 Region: 2034-2129
Classification Level Classification E-value
Superfamily beta-Roll 2.24e-19
Family Serralysin-like metalloprotease, C-terminal domain 0.0026
Further Details:      
 
Domain Number 3 Region: 1762-1851
Classification Level Classification E-value
Superfamily beta-Roll 5.91e-18
Family Serralysin-like metalloprotease, C-terminal domain 0.0023
Further Details:      
 
Domain Number 4 Region: 1448-1566
Classification Level Classification E-value
Superfamily beta-Roll 0.0000000000000209
Family Serralysin-like metalloprotease, C-terminal domain 0.0019
Further Details:      
 
Domain Number 5 Region: 388-592
Classification Level Classification E-value
Superfamily DNase I-like 0.000000000000134
Family Sphingomyelin phosphodiesterase-like 0.041
Further Details:      
 
Domain Number 6 Region: 1963-2026
Classification Level Classification E-value
Superfamily beta-Roll 0.000000000000484
Family Serralysin-like metalloprotease, C-terminal domain 0.0027
Further Details:      
 
Domain Number 7 Region: 1850-1913
Classification Level Classification E-value
Superfamily beta-Roll 0.000000000000497
Family Serralysin-like metalloprotease, C-terminal domain 0.0027
Further Details:      
 
Domain Number 8 Region: 1913-1965
Classification Level Classification E-value
Superfamily beta-Roll 0.0000000000209
Family Serralysin-like metalloprotease, C-terminal domain 0.0021
Further Details:      
 
Domain Number 9 Region: 2132-2182
Classification Level Classification E-value
Superfamily beta-Roll 0.0000000000458
Family Serralysin-like metalloprotease, C-terminal domain 0.0037
Further Details:      
 
Domain Number 10 Region: 1656-1763
Classification Level Classification E-value
Superfamily beta-Roll 0.000000000196
Family Serralysin-like metalloprotease, C-terminal domain 0.00096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427739918|ref|YP_007059462.1|
Sequence length 2353
Comment Ca2+-binding protein, RTX toxin [Rivularia sp. PCC 7116]
Sequence
MKTYKTISNKFGKVRDSKKSLLDKNLLFEFLNDEQLANRYFSPAAGFNKSVKFLAPLISD
ADDFDSANLNNLVLALGNQEKNDKYLTFTEPSKSVKYSNTLVFGSDDFNSQNFNHLLLGF
VNQKVNDDYLTSLPLSVSNSSNAPVLVGAEASQSNQKLQKNAAVNNKTLENNNDTVISRT
ISEVSKNPETQLDETKVKDNLTVVFAENLEIDNSSELELLDIYGIVDTALQDTYNYLGKF
RFDSEYSQKLKTAFGTGFNQKVADNLFDKFADGNFTDIPTIKVVNRSAIYGGNGAFSADT
GLVYLATEFLAENSQNTARVTDVLIEEIGHFVDSEINEFDSPGDEGDIFSELVQGNTLSD
EELQALRAENDTVTVVRNGEEVTTIPNKSNITIENNNTLRVGTWNVYHGNSQTGNITIPE
HLKRINYISKYGIKNNIDLIVLQEVKNSTQQPLLDDLLKFKNGQNPQKYDTQGLSKLTAG
YSYEIVSKEYPSSNLTPNKQTTDGYLILYNPSTINQISNPQHYQPNAFTKNGTQYRPPIY
FTVNKNGSKYNILTWHNETETSGAKTTLPQLTNVLSNTNQQFILLGDLNVKPNFLNQPNI
LPQQAGRHNNLSYITTDNGAVVDLLPNPNDQTKLKSDSHFALFAEIQSATSSAQSFTNTK
VRSKARLNAGPNRSHNPYNYNNITYEYSGNQAVPSWENQLIQIGKNERFFTPLKTVDGGK
VTVRKETVDGKTKEFVYIEKNSSGISPNVYSAIGNKTSSALFKGDVKFDTETLKGTITEN
GDSDDSDDSGFKLLGGIEVFFEGLSFDEDESGSPQLRLQGSMLLPGELVGGNGLEVAING
EDYIGFSDNGVSITGGSVKLPGENTLNILGLLEIKANDAEVQFDFDNQEATLQGTFSIPS
LKDATFELNGGNYIKIKKTDAGLDFSMVADINASNIPLFGEWEIENINLNINTPNDSFVV
NALLKTPGTPIELELAFNEGKLTQITGSSGVGTDFNFLGAAIDIQTVNVIVDRNTGDNEP
WDPEFSLQGEIEIPQLKGLKGSLTGNNKLIVTKDGVELTGAKLSLDEIKFGNWRLRDIEV
EYNAQQGIFAGGATLSDSTGIEIGVFLEFDKDGLKRIAANASDLKLLDFTVSDVEVDFTI
DKNREDNQPWDPEFVLGGKITNNKVSAGWKIKEAAFKIDTTNNQTKIFAAGTIEIPSGVE
VDATVYWNGNELESIEIDVEDLNKPIGKPIAFLQSMSGSYQGSTTEFSGSVGITLGPQID
LQQIRIPFVDIPQEKVSLLRLDLTATVTPEYFNGKGEVTLLGGLLGSRTGEINLNWKHNS
FLAKTELDILWGLIKADASLIGRGRGESQFDIYAFAEGSINVPNIIPVIGGFKLGSGGAY
FQFIDDGDMSNDYVAAWGQFLFWDVAFKFGFDGSINLINPQISQFARDNIADLEHNINNS
YNTPADLQISPEGTIEGKGTPGDDFLKGQDDDNTLDGGDGNDVLSDRAGNNLFSGGAGND
ILIGGWGNDTYVFDTDDAQGADTINETMIAVKTFHNTYVKASRPDTGNWHLAQNSFIGDW
EKFTVVNNGDGTISLRTFHEHHFWKADNIGRDVFGYWNVQQNSYIGDWEKFRVESHSDGR
ISFKTFHGNFAHYVRAYDGNGNGIDQVRDLGNWQKFWVENQDNNSKDTLDFSETTTKTIN
LDLSNPGQQQINENLALTLGITIGSQTFINIENAAGGSLNDTLRGNHLDNRLLGKNGNDW
LSGEDGRDTLIGGAGDDYYLGGGAGNDYLDGEQGNDWLSGEEGQDTLKGGAGDDHLYGGD
ETPNGDSANDTLLGGTGNDYLNGEQGNDWLSGEEGQDTLIGGTGDDHLYGGDETPNGDSA
NDELWGGTGNDYLGGEQGNDYLDGEQGNDWLSGEEGQDTLKGGAGDDHLYGGDETPNGDS
ANDTLLGGTGNDYLNGEQGNDWLSGEEGQDTLIGGTGDDHLYGGDETPNGDSANDELWGG
TGNDYLGGEQGNDYLDGEQGNDWLSGEEGQDTLKGGAGDDHLYGGDETPNGDSANDELWG
GTGNDYLNGEQGNDWLSGEEGQDTLKGGAGDDHLYGGDETPNGDSANDELWGGTGNDYLG
GEQGNDWLSGEEGQDTLKGGAGDDHLYGGDETPNGDSANDELWGGTGNDYLNGEQGNDWL
SGEEGQDTLKGGDGDDTVYGGLEENPIGDSANDQLWGGAGNDYLDGEQGNDWLSGEEGQD
TLKGGDGDDTVYGGLEENPIGDSANDQLWGGTGNDYLGGEQGNDFLRGEQGNDTLTGGTG
ADVFAFEVNEGIDIIEDFSASDGDKIQIGTSFNTIDKSQFSYDSTTGDLKYFHTHFATLN
TDSGFDVNQLTFA
Download sequence
Identical sequences K9RLW6
gi|427739918|ref|YP_007059462.1| WP_015122464.1.44015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]