SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427739919|ref|YP_007059463.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427739919|ref|YP_007059463.1|
Domain Number 1 Region: 3-212
Classification Level Classification E-value
Superfamily SGNH hydrolase 2.54e-28
Family Acetylhydrolase 0.026
Further Details:      
 
Domain Number 2 Region: 514-740
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.48e-22
Family Clostridium neurotoxins, the second last domain 0.023
Further Details:      
 
Domain Number 3 Region: 951-1169
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.8e-22
Family Clostridium neurotoxins, the second last domain 0.039
Further Details:      
 
Weak hits

Sequence:  gi|427739919|ref|YP_007059463.1|
Domain Number - Region: 236-326
Classification Level Classification E-value
Superfamily Cadherin-like 0.0133
Family Cadherin 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427739919|ref|YP_007059463.1|
Sequence length 1174
Comment hypothetical protein Riv7116_6589 [Rivularia sp. PCC 7116]
Sequence
MNQNALKIVTIGDSITQAENGYNSYRKELWELLNEAGYNVDFVGSENRNKDGGNFEDRSF
DPDHEGHWGWRIDEIINGRGGDNLSDWLTGYTPDVALIHLGSNDAIQSNSAVSSVEELKQ
VIDILRQDNPNVTIFLSQLIPAVNGGFNNRIQQLNSLIPGIVADKNQANSPVILVDQNSG
FNANTDTYDGVHPDPSGEAKMAQKWFDALKNYFDSVGINPDDGDSSPPLPTNNSPNAVND
AFTINENTSDNLLRVLANDSDSDGDSLAVSINAQPGNGSLNIVQNEFFYTPDADFTGVDT
FTYQVDDGNGGTDTATVNVTVNNVNNIPLAANDSASTNEDTAVSINVLANDSDADGDNLN
IASVSSPNNGTTAIVDNEIVYTPAANFNGVDSFNYQVEDGNGETQTATVTVNVAPVNDQP
LAQNDAATTNQDTEVSIDVLANDGDIDGDNLTIASVAAANNGTTAIVGNEVVYTPASGFS
GEDSFTYSINDGSGVNQTAQVNVTVAAVNPTNPTNPTNPSTRVDAGLLALYNFDEGSGDT
VFDVSGVGTALNLQIDNVSRTSWGNGVLNINAPNLIASNGTADKLIDGITATQEITLEAW
VTPENRSQNGPARIATLSSNVSNRNFTFGQAGDDYNVRLRTTSTGNNGVGRTVSSNGGLL
STELTHVIYTREADGDAALYINNQLVASENIGGNLSNWNDSYSFALGNELTGDRPWLGSL
DLFAVYNQAFDAGEVEQNFLAGAEDSASPQTPPPDNNPTNNIPVVANDSATTNEDTAVSI
NVLENDSDADGDDLNIVSVASANNGTTTIVSNEIVYTPAANFNGVDSFSYEISDGNGGIE
TATVTVNVAPVNDQPIAENDTATTSEDTQVSINVLANDSDVDGDNLTVVSVAAGNNGTTE
IIGNEIIYTPEAGFTGEDNFTYSINDGSGVNQTAQVNINVTEAGSNNSSERVDAGLLALY
NFNEGRGDTVFDVSGVGTALNLEIDNVTGVSWGDGELTINSPNLIASNGTATKLIDGIKA
TQEITLEAWVTPENRSQNGPARIATLSSNVSNRNFTLGQAGDDYNVRLRTTNTGNNGVGR
TVSSSGGLLNTELTHVVYTREADGDAALYIDNQLVASENIRGDLSNWDDDYRLGIGNEFS
GDRPWLGSLDLFAVYNQAFDAGEVEQNFLAGSDF
Download sequence
Identical sequences K9RN12
WP_015122465.1.44015 gi|427739919|ref|YP_007059463.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]