SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427740162|ref|YP_007059706.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427740162|ref|YP_007059706.1|
Domain Number 1 Region: 2-350
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.12e-73
Family TK-like PP module 0.0081
Further Details:      
 
Domain Number 2 Region: 291-481
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 5.52e-62
Family TK-like Pyr module 0.02
Further Details:      
 
Domain Number 3 Region: 494-626
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 3.8e-38
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427740162|ref|YP_007059706.1|
Sequence length 636
Comment 1-deoxy-D-xylulose-5-phosphate synthase [Rivularia sp. PCC 7116]
Sequence
MHLSEITHPNQLHGLSIRQLEQIGRQIRDKHLQTVAATGGHLGPGLGVVELTLGLYQTLD
LDRDKVIWDVGHQAYPHKLITGRYNHFHTLRQKDGVAGYLKRCENKFDHFGAGHASTSIS
AGLGMAIARDRKGENFKVAAIIGDGALTGGMALEAINHAGHLPNTNLLVVLNDNEMSISP
NVGAIPRYLNKMRLSPPMQFIKDNFEEQVKQLPFVGGDSIPPELERIKEGMKRLAVPKVG
AVFEELGFTYMGPIDGHNLEDLIATFKQAHKIPGPVLVHVATTKGKGYDIAEKDKVGYHA
QSPFNLTTGKAIPSSKPKPPKYSKVFAHTLVKLAEQNPKIIGITAAMATGTCLDKLQAKL
PDQYIDVGIAEQHAVTLAAGLATQGMRPVADIYSTFLQRGYDQIVHDVCIQNLPVFFCLD
RAGIVGNDGPTHQGMYDIAYMRCIPNIVMMAPKDEAELQRMTVTGVNYTKGPIAMRFPRG
NGYGVPLMEEGWEPLEIGKGEILRNGDDVLMIGYGSMVNSTLQAAEILSEHGIEATVINA
RFCKPLDTELMFPLAKKIGRVVTLEEGCVMGGFGSAVAEALIDADILVPIKRFGVPDILV
DHATPDESKAELGLTSPQIAQRILKTFFSNQPSAVV
Download sequence
Identical sequences K9RPD1
WP_015122708.1.44015 gi|427740162|ref|YP_007059706.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]