SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427733887|ref|YP_007053431.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427733887|ref|YP_007053431.1|
Domain Number 1 Region: 230-395
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 4.85e-40
Family Histidine kinase 0.00076
Further Details:      
 
Domain Number 2 Region: 11-103
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.3e-30
Family KaiB-like 0.0011
Further Details:      
 
Domain Number 3 Region: 151-236
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000000000942
Family Homodimeric domain of signal transducing histidine kinase 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427733887|ref|YP_007053431.1|
Sequence length 398
Comment histidine kinase,KaiB domain-containing protein,histidine kinase [Rivularia sp. PCC 7116]
Sequence
MQASQGQQLINSEAPLQLLLFVDERPKSRLQIQQIRSYLQQLQLEYDFELQIIDVGKQPH
LAEHFKLVATPALIKIHPEPRQVLAGSNIVSQLKTWWSRWQTSVESYLQLQQEFQQAVEN
DPDGYIKKSEIPTNSLAISAEIIELSDEVFRLKQEKQQLQEQLQFKDRVIGMLAHDLRNP
LTATIIAIDTLKSNYNSETGEFRRLTPALTAHMLNHARTQTKVIEKMITDLLQVGRGKDT
KIPISPQKIVLGDICLEVLEELRESYKAKSLEIIKDIPQDLPYVYADPERIRQVVINLLD
NAIKYTPPEGTVTIAGLHRTSQKVQFSIGDSGPGIPQENRDRIFENRFRLERDEAKDGYG
IGLSLCQKIVQAHYGQIWVDRAPTGGAWFHFILPVYPN
Download sequence
Identical sequences K9R6D4
WP_015116462.1.44015 gi|427733887|ref|YP_007053431.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]