SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427739608|ref|YP_007059152.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427739608|ref|YP_007059152.1|
Domain Number 1 Region: 21-346
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.69e-45
Family Filamentous hemagglutinin FhaB, secretion domain 0.0085
Further Details:      
 
Domain Number 2 Region: 309-465
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000000000628
Family iota-carrageenase 0.082
Further Details:      
 
Weak hits

Sequence:  gi|427739608|ref|YP_007059152.1|
Domain Number - Region: 481-573
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00816
Family P22 tailspike protein 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427739608|ref|YP_007059152.1|
Sequence length 746
Comment filamentous hemagglutinin family domain-containing protein [Rivularia sp. PCC 7116]
Sequence
MRDLHYILLALSVTFLLLPVSEVEAQLIPDNTLGKENSLVNPVNSVQRIDGGTIRGSNLF
HSFQEFNIGSGKSAYFSNPGNIENILTRVTGKNSSLILGKLGVLGNANLFLINPNGIIFG
ENAQLDINGSFVGSTADNIKFADGREFNAVNPSANPILTINVPLGLQYKGNGGNIEVRGT
ATSNLKVPDKKSLALAGGNIKFDGGKLTAPAGGIDLFAVTNGEVSLVNSNGRINLKTPLG
IEYGDIEFLNASNIDASGNSGGSIQVRGRNISLKGNSIISTNTDGDGFGKTLNITATELL
KISASDLFADVQDNATGTGGDLVVNSKNLIVTDGSILSSSTFGLGNSGNLTIKTINLQVD
NAGRIDVTTYDFGNGGNLTIETANLQVYDGAQITAIAFGKGNAGNMEIKANLVELVGFRQ
SSDIPLKSGLFANALQENGQGGNLNVTANRLVIRDGATINASNFLSFDPDNLLGRAGTGA
AGNIDINSPFVLLENQGIITANVNAGDKGNINIQSQNLQLRKGSVISTNAKNSADGGNIN
IDTNTLVALENSDIAANSEGSFGGRVIINAKGILGTQFQQQLTPQSDITATSSLGASFSG
VVDINTIAVDPNSGLIELPQTLTDSSQKIKAGCDATAGNNFVVSPRGGLPQSPDDLFNGS
TIYTELNDVIPIQDIASDINDRNHQNYRNRLSSVENKHKNQNKNQIVEATGWVVDGKGDV
VLVAKMPQHSQKSPKINSASCNDFSS
Download sequence
Identical sequences K9RKX3
gi|427739608|ref|YP_007059152.1| WP_015122154.1.44015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]