SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ABX80955 from Acholeplasma laidlawii PG-8A

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ABX80955
Domain Number - Region: 3-28
Classification Level Classification E-value
Superfamily BT0923-like 0.0288
Family BT0923-like 0.012
Further Details:      
 
Domain Number - Region: 39-112
Classification Level Classification E-value
Superfamily Cobalamin (vitamin B12)-dependent enzymes 0.0706
Family Diol dehydratase, alpha subunit 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ABX80955
Sequence length 189
Comment pep chromosome:ASM1878v1:Chromosome:345026:345595:1 gene:ACL_0333 transcript:ABX80955 gene_biotype:protein_coding transcript_biotype:protein_coding description:conserved hypothetical protein
Sequence
MIVKEVRKLKTNYQVEFQNGYKLTIDEDTLVQYRLRPGIEVESVEVLQKAMEKHKLLNKA
IKFASYGKSENQVIKYLNEQGMHNTYDAIMTLKKMRIIDDYKMIRGLQNKGYSYLQLEEK
LKFYQFEQKDIDYALENYNERIPLYKQFKLALKKYEKETDYKKKQQKIYRYLMSKGFNED
SVMSVMNIS
Download sequence
Identical sequences A0A2G7QHD2 A9NF25
gi|162447199|ref|YP_001620331.1| WP_012242286.1.15573 WP_012242286.1.46366 WP_012242286.1.71135 WP_012242286.1.72193 WP_012242286.1.73551 WP_012242286.1.92431 441768.ACL_0333 ABX80955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]