SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ABX81107 from Acholeplasma laidlawii PG-8A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ABX81107
Domain Number 1 Region: 8-76
Classification Level Classification E-value
Superfamily BT0923-like 0.0000107
Family BT0923-like 0.017
Further Details:      
 
Weak hits

Sequence:  ABX81107
Domain Number - Region: 39-147
Classification Level Classification E-value
Superfamily Hypothetical protein MPN330 0.0523
Family Hypothetical protein MPN330 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ABX81107
Sequence length 185
Comment pep chromosome:ASM1878v1:Chromosome:512351:512908:1 gene:ACL_0489 transcript:ABX81107 gene_biotype:protein_coding transcript_biotype:protein_coding description:hypothetical protein
Sequence
MKKQVIQRTETIDLVNGKKVFFDYDGNLFSINREVPEYRHYNVPKDVEDVWKKTIINNLL
EEVENSIGYEKTVKVTKLLAIYGHSNNIQLLEALLEDDTLDTFSKILYLEDLNREKLGVN
ISIKYKILKIEDPKSYITDLNDKILDYKSKLLNSPITIDESFKQNYALKYYDFSDENIIR
RIENI
Download sequence
Identical sequences A0A2G7QKW2 A9NFH7
WP_012242438.1.15573 WP_012242438.1.20474 WP_012242438.1.46366 WP_012242438.1.71135 WP_012242438.1.72193 WP_012242438.1.92431 441768.ACL_0489 ABX81107 gi|162447351|ref|YP_001620483.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]