SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ABX81450 from Acholeplasma laidlawii PG-8A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ABX81450
Domain Number 1 Region: 86-147
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000000353
Family NfeD domain-like 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ABX81450
Sequence length 152
Comment pep chromosome:ASM1878v1:Chromosome:869783:870241:1 gene:ACL_0836 transcript:ABX81450 gene_biotype:protein_coding transcript_biotype:protein_coding description:hypothetical membrane-anchored protein
Sequence
MIEFLAEYAIWFWLLVFVTTIIIEFMTVEFVSIWFALASIPTLIISIFMPTNIGLQMIVF
FLTGFILMILTRPALVKYFKKNIVSTNVDAYVGKSAIVIKEISPLTRGQVDFEHMNWTAI
SSEDIEVGATVRILAIEGNKFIVTKINKEDLN
Download sequence
Identical sequences A0A2G7QJW1 A9NGH0
WP_012242781.1.15573 WP_012242781.1.20474 WP_012242781.1.46366 WP_012242781.1.71135 WP_012242781.1.72193 WP_012242781.1.73551 WP_012242781.1.92431 gi|162447694|ref|YP_001620826.1| ABX81450 441768.ACL_0836

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]