SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ABX81729 from Acholeplasma laidlawii PG-8A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ABX81729
Domain Number 1 Region: 5475-5536
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000000216
Family Type I dockerin domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ABX81729
Sequence length 5552
Comment pep chromosome:ASM1878v1:Chromosome:1166312:1182970:-1 gene:ACL_1119 transcript:ABX81729 gene_biotype:protein_coding transcript_biotype:protein_coding description:large hypothetical protein
Sequence
MAEGQDGTETNPYIISNAEDMNALSQAVLAGNTFAGKVIVVSSTVNEIGLGNFIPIGSPT
KPFAGTFDGFGVKFILNINRPESDYQGLFGYVNGGVIENLSVSGRVFGKSYVAGIAGFHT
NSRILNVYNEAFINGALNYVGGITGQTYYNGILDYAYNTGEIIGGTYVGGITGGIYAAYT
NNSYLRHVYSRGKVAGKGSVGGVYGVASGGSYLGLTNAYYDVIVIANYYQPEGYVKPSSL
ETTAHAKNSQQLYDMDSKSLHGDYWHFEPRTEGFGFYPQLKYFINHPNDTLAYKKNSSIQ
SVKVDITDGIGTQSFPFIIYNEEDFIELNNKVKNGNTFEGFYFKVADGVTRFVFEDYEPI
GTPTKRFYGTFDGNNAEFHINTLDTTKDYQALFGYFGVGVIRNLYVTGSVKGNDYVSGVV
AYQVSGTVENVYNLASIEGRHYTGGVVGYMTGATVQRVYNHAKVTSTGNYVGGVVGAAGL
QSHIYNTYNRGEVIGADLVGGIVGQILASYQNNSNIRYNYNAAYVSSKSRVGGVYASASG
SYLTDTNNYYDTSILTDFDPGLGYNKPGTTNIAQGKTSDFLLFSELVTLGYNAAIWELKA
KSGDYAYYPQLKIFTTNPNVEIKLDSIDSVKMDVSYGFGTKTTPFLIKTEQDMHDLSLAV
SKGNTYLNYHFKVDAGLTEFDLGNFIPIGSPTKPFLGSFDGNGANFILDINRPDSDYQGL
FGYHTTGVIENLSVSGSVTGRNYVSGIVGYHTGSRVQNVYNTANITGTENYVGGITGQTY
YNGILDYAYNIGEIIGGTYVGGITGGIYAAYTNNSYLRHVYSRGKVAGKGSVGGVYGVAS
GGSYLGLTNLYYDVIVIANYYQPEGLIKPSSLETALHAKNTSQMIQGSALLPNTHFYFEE
KTDELGYYPQLKVFSQNEVATTKTRSKESVTLDIKDGMGTSDMPFIIYNEEDFIELNNKV
KNGNTFEGFYFKVADGVTRFVFEDYEPIGTPTKRFYGTFDGNNAEFHINTLDTTKDYQAL
FGYFGVGVIRNLYVTGSVKGNDYVSGVVAYQVSGTVENVYNLASIEGRHYTGGVVGYMTG
ATVQRVYNHAKVTSTGNYVGGVVGAAGLQSHIYNTYNRGEVIGADLVGGIVGQILASYQN
NSNIRYNYNAAYVSSKSRVGGVYASASGSYLTNTNNYYEVTMLRTFTPLSGYVKPSDALG
GQGLDKATMFNDQMLTRGFNLNTWTFKEIEGNYAYFPQLKYFAENANEHVVNDSIISTRT
NPFTGDGTKESPYLIRNVDDMVILSHSISHEYDALGKYYIVAPNVFEMNLVGTNYKPIGQ
DVPFKGHFDGDYTHFIIELDMMDKNYVGLFGQLSSGASISNLSVSGTIKGNNYVGGVAGK
NDGQIENVYAKVHVTGNQNVGGLVGYNKGSLDTMFSTGNVTGSQGVGGLVGFNEGTIHEG
YYGGRIHGQNHVGALVGFSSNELISNLNYNGTIIYYDDILDGFIKPNNAVGNLIVFNHFK
VEKEALTGIEVFSQEGILLSNDLWKLSPTNGLYDYYPQLKSFAEHASSVVRTNALLYTSV
IRFANGSGSKSNPYIIRHEADMKALSDITKSNNLDGIYFKVIDGVSLLDLTIEGLGFERI
GHSASINQQFKGGFDGNGVTIQIELLKTTTDYLGLFGYLGQNAEVKNIEITGKVHGRNYV
GALAGEINGASISNIFNHAEVLGTRYVGGLIGLSTNSNINNIYNMANVTAISRDIGGIIG
FSQTSTISKVFNFGHIKGVQVVGGIVGYLYNANNVSYVYNRGMVEGTTTATYIGGITGAH
RNGQISQGYSAGVILGKNTGYLGGLIGRIEGTTFESDIYYDASIIDSIVVPTGYNVPIQS
IGNKLNQEHIKGLSKTEIVGLKGQSNMTLDSNEWVFIETNGVEAFYPQLKVFSTHLSERV
QKDSIESVKSYVFVGEGSFDVPYVIVNKYDMEILSNLVSSGIDFEGIYFKVKEDVSVIDL
TYEVNYKPIGSIATQFKGSFDGTHTNFVVKMNTSSNYQGLFGYLGDTAHVKNLSVSGSIT
GNNFVGSIAGVNYGVIENVFTTADLVGKDNVGGITGSNHGEVRVSYAIGSVRGNEHIGGI
SGNNTGIISDGYASSNIYGTSYVGGIVGSNASELYNLYYNESKIEVSPDITGYSKPFIAT
GNQGNTDSVYGVVSHKLYSGTLVFENEWTFENSVGFYAYYPQIKGFSKSIYKPIKDYSKD
SVTISKFNEGSGTFEDPYIIRTHYDMESVSQMIGARYSLLNTYFKVASDVDYIDLTLLDI
PYVPIGNSSVNFQGSFDGQGVKFNINLNNNFEYQGLFGVIGSNGYVKNVSVEGSIKGTNF
IGGISGRNYGIIENSYNLAHITGTNYIGGISGYANHDIINTFNTGNIQSTGVYVGGITGG
IVRNRMIKNAYNVGNIHSTLSTSLRGTGGIAGYLGGNLYNVYQASPITSERSGYISGLYG
RTDGVSVIENAYFAIEPILNDTSGYFKPSTIGPNAVYKNQLTSEQLFVTFETGVFVSRQS
QAFDAFYPQLKVFETSSKSHITTDSRNSVMHPLLYGEGTSINPYLIYSSYDLRGLGIAVK
DGLDTIDQVYKVYQDAIIDFEPIKNLYEPIGTYSNPFKATFDGSNQTINLKIENPNKDYQ
GLFGVVSEDALIKDLLLEGEVQGKHYVGALAGRLNGVVSNIYIKDMVVTGHDYVGLLAGD
SQITELLNISLKGVVEGLSYVGGMIGHSQTITANATYFMGSIYASSNYVGGLIGYIETES
ILTNVFSSGVIHASKSNYVGGLFGHFKGSLEHAYATTSITANSYAAGIAAIHEGEINEIF
YSGQLSANSYAAGIVVENKGLISNAYYNSTEIENMKQLDSNKLVKHAIYNVEDSAHVSAR
TLSEMTFIYSLGDDITQMNFDQSLYQTKQGTDFTTYFPELYIFIDHAYNVFVEDSLESIT
YNKLEGLGTKLNPYLIYDGYDMMIIGDYVRDGHEFVGKYFEVAPKVTQIDLTLEDLGYTP
IGSNEYNFGGIFDGKQARFIIELSTNSEYLGIFHTIGETAKVSNMVITGNIRGHAYLGGL
AGRNLGTIENIYNHAHITSTLGNDIGGIVGFNQGTIKRVTNQGKITSNGSYTGGITGQND
GVIMDAYNRNDVTGFSNVAGITGHNMGEISNSYNSGHILAKDSIAAGIAGTNSSIIYQVF
NSGQIIATNQNAAGIVGNFSAGNLSEAYNAGMILSKKGQAAGIVAYMNTGSISSVYQFGE
IYSVEDIGIIIGFIENGNLSSIYYDIDVTNQSDLSGYKKPQYPVGNKTSDVRTNGLYHGQ
MIGMHALSVTNMNLANPNKYKMLPSLISTSFYPQFTVFSNSSFDYVREDSLKSVETHTFI
VGDGSMVNPYLIRNESDWLALADSTTNGNSYKGVYFEVSSDIDELNFVDHPSNYKFAPVG
TKDKPFSGILDGKGINVRVHVSNQLDYQALFGHIGTTGEVRNISVSGHISGRNSVSGIAA
INDGVIENVYNQAVIVGNQYVAGIAATNNGVIKNVYNKGKVTGSDYVAGLTAYLNGTLYN
SYNTGVIYGKNHIGMLVGFYHTGSIHNSYFDVTLLGAYRNTTTHTKPLGAVGSSFNGDNV
KGLDHRFMIGQNVFGASSNQMNFVSPLDHWSTNYNLNELNENYPQLKVFAQDSRAHIQAL
SKESTYNRLYTVTFEELNETTNENLQYVLDNEHYQLYVPTYFGYNFLGWYYDQDGIEIQL
TNKSGQSIQVFNEEKDIEVYAKWEEAYHLVQFIDGNNKVIHEEEIRHGQYVQQPDGLIPL
KNKNALYVYEYMRWIFDFNGTQILKPTQIRAEYHQMDRYYTINYYDGDGHLFERQKGEYN
QYIQPTSKIPTKTYDTYAYHFEGWDYNFNVVITESMDIHPIFTPVQRYYEIKFYNFDGMH
IETKMGEYLFSVEPPSVLPIKAQTPEFKYEFSGWDKDISSITTSMDVIAQFKEVRRSYTV
NFFNGDGSILSSQQVLYGDMAAHPSEVPTQAPAGNDAYKFDGWIEDYAYITENLNVRPKF
IRVDRYYEVSFYDAFGKIIDKVQVVEYLNSAVQPINNPTKPSSVSEIYTFDGWDQDFTVI
TGNLEIYPVFKSSPRTYQVTFMIDQDTVYKTVETEYGKTAILPEGIPFKEGTKEIGYKFI
SWGANYKNITSDTLVYANYQEVAGQYLITFTDGATILNTQYVLYGKDAVAPDLTTYLKDH
PNQATGYEYYFISWSSTLDFITAEKTINLNKGSRLISYEVTLINGDETTKIQVGWGQNVT
FPVGYKTSTNQIKYTFVGWDNNGLAVKENRTIKALFDETYLYYEVRFYDKFNNLIKLQEV
APGSNALAPAVDIIDQQNGTLLIFNRWDKDFTNVEENLNVYAIYDTVNDSFTVNFYDAFN
KIISSQIVKYNEAATEPNAPSKIIDGPYAYEFIGWSEDFSNVKSNLDIYPEYEEKEITFT
VNFFDGDNRLIKTDYVKYGLDAIAPSVATKTPTQNIFYIFDGWKTSYSGVTKNLDIEAKF
IEVPRYYTVNFFDKDDNIINTQIIEYGQDAKDPRFMEGFNPIISYLENDQVLVISGWDQD
LINVRENRTIYALYSEVNRYYEVRFYDALNNQIGDTQIIEYGSKAFEPTTPIKVSPNPDF
FFLFTGWSEPSNYVTENLEIYPTYNYVKTTYQVTFLDGNGNVFDEQTISYGQSAITPNGI
PSKTPTDDVSYVFKSWDVNYDVVTSDLIVRPIFDMVTRQYLVIFKNDKGIIIKEELVNKG
SSAKAPDVPILESDNYYHYMIRWSVKFDNVTEDIVTELYYEKIERIYTLTFYDYDTTTII
STITATYGQVIMAPSGPIKPADRQFSYEFISWNPVFNEVVTSDENYYPYYEEHLRVYIVT
FLDGNGNVFDEQEVYYGATPKMPLNTPTKDPNKQYYYTFRMWETLTVKVYEDITIKAIFY
NHLQEYEVTFIDEFGHVIEKQMVKYGEGAVEPNTDDIPVKSSTTSTVYVFSGWDKTFSFI
TEDLIVQTQYLGTPRKFIYTFYDDDQTTILKQIVGAYGDPIIEPNVVNKPGGEGFDYAFD
GWDKVVPEILTEHMIFVARYKEVYKEYKVTLFDGNGALFKTLTVLHGQTLIPPTEIPSKL
PTMQYTFVFSHWVIKGSTTVFNIFEESVTQDIQLEAAFNQEIRLYVVTYMSGEEVHEEVI
VPYNGRPIIPSDPEKPGYRFTNWDKHIDRVTGDMTVHAVFVAGRYNIIFNDGYNEGDEVI
VEGSMTPMTVNFDDNVVLTDLGYVRKGYDFMGWIVDGNVLPSYGDGDSFTYNNVGSLVLT
AYWQPISYGISYDLNGGLAINPTMYTIEDYIRFNQANKNGYKFVGWYMVEQDETSQDMRQ
MARRQANILANEDLGTYIEEIKPNTVIGSIKLTAVYEYDSYIKLKPESMLGMFHAEVTSV
IPIEERNYYDETNPIYLMGVFQNQTWANLKENFVNKELYFLDKNGKELTDQDIVASGRMI
VIKDSNGNITDRVHVVLKGDINGDGRVNVMDQTTLINHLNRKQPILLSNLLAADTTGDGK
INVLDQTALINHLNSKTPFWDKNQTTTMNLGE
Download sequence
Identical sequences A9NH99
441768.ACL_1119 gi|162447973|ref|YP_001621105.1| ABX81729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]