SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ABX81894 from Acholeplasma laidlawii PG-8A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ABX81894
Domain Number 1 Region: 10-217
Classification Level Classification E-value
Superfamily PhoU-like 4.6e-58
Family PhoU-like 0.0000158
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ABX81894
Sequence length 221
Comment pep chromosome:ASM1878v1:Chromosome:1357589:1358254:-1 gene:ACL_1299 transcript:ABX81894 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:phoU description:phosphate uptake regulator
Sequence
MSALRASLLKAIEELKGEVVTMADLVLNNINESFLAFKTNNLTKAESLMKADDQVDQLEE
DISKAALRVIWKEQPYAQDLRVVTGILKLVTDLERIGDHATDIAEQTIHIGDLKNQRLLP
KTTIMSEAAYQMVLNAINAFVKQDIQLARQVIEDDDIVDAQFNDVMASVTEQIKNDSIDS
QYAVSVIMVAKYMERVADHAVNLAEWTIFMITGEHKKTPLF
Download sequence
Identical sequences A0A2G7QIJ7 A9NHR4
441768.ACL_1299 ABX81894 WP_012243225.1.15573 WP_012243225.1.20474 WP_012243225.1.46366 WP_012243225.1.71135 WP_012243225.1.72193 WP_012243225.1.92431 gi|162448138|ref|YP_001621270.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]