SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AMAG_05378T0 from Allomyces macrogynus ATCC 38327

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMAG_05378T0
Domain Number 1 Region: 293-575
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase FAD-binding domain 2.09e-94
Family Cryptochrome/photolyase FAD-binding domain 0.0000002
Further Details:      
 
Domain Number 2 Region: 63-254
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase, N-terminal domain 3.4e-36
Family Cryptochrome/photolyase, N-terminal domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AMAG_05378T0
Sequence length 580
Comment | AMAG_05378 | Allomyces macrogynus ATCC 38327 deoxyribodipyrimidine photolyase (581 aa)
Sequence
MAPSASRRPRSPSTNNLADAYGNNSSNSTMAPPPAKKPRATSAATPATTASAARPASPRQ
QGPVVFWFRSKDLRLRDIRRSNRAWVQTAQSERGSALNGALLTCFVVCGPQYTMHDYAPA
KVDFLLRNLRDLQTRLEAEFQIPLTVLHAASWDEVPQVVAGFVERVGATHLYYNHEYEVH
EARRDAAVQTLLAPKGVACVGAHDECIVAPGVVKSKENKVYTVYTPFRKAWQDLVKRKHP
QDWLAMSPDPGANPASVRTVVPDLFGTAIPEATHEGLPGYTLPIDESVLAHTRAAWPAGE
TAAHDRLKRFAQSKLSAYSVDRDFPALDGCSSMSGYLTTGVISARACFNVARAANGGQID
TGDKGAVHWMQELVWREFYRHILVAFPRVSMNQPFKLDTKLVKWTDHDPATKDEAERHFA
AWCEGKTGYPIVDAAMRMLVQEGYLSNRLRMVAAMFLTKDLLIDWRRGERFFMRHLIDGD
LAQNNGGWQWSASTGTDSQPYFRVFNPYLQSEKFDPDAVTIRKYVQELRAVKDSKALHEP
HARLPAAVFVRTGYPRPIVDHKAARVRAINAFKIAAGKVV
Download sequence
Identical sequences AMAG_05378T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]