SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for adi_v1.00024 from Acropora digitifera v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  adi_v1.00024
Domain Number 1 Region: 141-259
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.66e-25
Family Spermadhesin, CUB domain 0.00097
Further Details:      
 
Domain Number 2 Region: 20-143
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.13e-24
Family Spermadhesin, CUB domain 0.0014
Further Details:      
 
Domain Number 3 Region: 264-385
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.18e-23
Family Spermadhesin, CUB domain 0.0013
Further Details:      
 
Domain Number 4 Region: 384-421
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000563
Family LDL receptor-like module 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) adi_v1.00024
Sequence length 588
Sequence
MAAININWIILQLLALWSGICFSSCRNLVKGESGDLRFPLIGEGNPGEKLDCIWTVNVPE
QFRVKLTFTDFVMKTSCCSCVHDFLEIRDGSLANSTLIGRFCAKKEPKYVFSTRSVIWIR
FLSDFRTYSGNRFRLSFEAVCGGHYTSSSGNFRSPAYPLHYGNNKDCIYSIAVPKGRIKV
TFERFKIEGRMPVCLHDYLEVKEIRHVDYSRSQGHSRQSRYCGNDKPPTIYSTRGSYLWF
RFKSDLSGVDAGFSAYYRTISTGEGTCGGTFKDKSGFMFSQNYPYRFPSGQECTWKIQVA
SDMHVHLYFDSMNFGVNLGGCSHTYLEVFDVQDTSHRIGQYCGDSIPSNIVSRTNKLLIK
AVSKAEARETGWFSLRYESSTTGACGLQKFTCVNRQCIEYYYECNSHVECDDGSDEQSCP
SREGTNILKWYKFWPVSVVGGMLIVGIWLWRAWKKIKSARSEIQNFEAVTPTPSQMEMLP
CNHSVELPSYSEAVAQANKLPPSYEEALREQINLPEMDRDSAQDPNPQGSMDNSSLNDSC
GAHSSRNGPTSLPSMVVCGVTALPNDNHGSTYEAHRAKTGESCHGQRV
Download sequence
Identical sequences XP_015766399.1.88439 adi_v1.00024

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]