SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for adi_v1.00468 from Acropora digitifera v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  adi_v1.00468
Domain Number 1 Region: 526-783
Classification Level Classification E-value
Superfamily YWTD domain 1.7e-51
Family YWTD domain 0.000011
Further Details:      
 
Domain Number 2 Region: 1696-1955
Classification Level Classification E-value
Superfamily YWTD domain 4.97e-45
Family YWTD domain 0.0000144
Further Details:      
 
Domain Number 3 Region: 1391-1650
Classification Level Classification E-value
Superfamily YWTD domain 2.35e-42
Family YWTD domain 0.0000147
Further Details:      
 
Domain Number 4 Region: 2717-2967
Classification Level Classification E-value
Superfamily YWTD domain 1.1e-39
Family YWTD domain 0.0000064
Further Details:      
 
Domain Number 5 Region: 1143-1347
Classification Level Classification E-value
Superfamily YWTD domain 4.71e-26
Family YWTD domain 0.00012
Further Details:      
 
Domain Number 6 Region: 353-475
Classification Level Classification E-value
Superfamily YWTD domain 8.24e-24
Family YWTD domain 0.00013
Further Details:      
 
Domain Number 7 Region: 2502-2542
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000013
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 8 Region: 908-951
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000034
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 9 Region: 829-865
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000458
Family LDL receptor-like module 0.00095
Further Details:      
 
Domain Number 10 Region: 2378-2415
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000524
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 11 Region: 152-188
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000916
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 12 Region: 2999-3042
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000995
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 13 Region: 3207-3243
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000144
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 14 Region: 2256-2296
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000144
Family LDL receptor-like module 0.00082
Further Details:      
 
Domain Number 15 Region: 3287-3328
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000017
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 16 Region: 1982-2145
Classification Level Classification E-value
Superfamily NHL repeat 0.000000000314
Family NHL repeat 0.031
Further Details:      
 
Domain Number 17 Region: 2296-2335
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000327
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 18 Region: 31-68
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000038
Family LDL receptor-like module 0.00086
Further Details:      
 
Domain Number 19 Region: 990-1029
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000445
Family LDL receptor-like module 0.00088
Further Details:      
 
Domain Number 20 Region: 3163-3203
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000772
Family LDL receptor-like module 0.0009
Further Details:      
 
Domain Number 21 Region: 3249-3284
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000107
Family LDL receptor-like module 0.00083
Further Details:      
 
Domain Number 22 Region: 3045-3083
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000131
Family LDL receptor-like module 0.00083
Further Details:      
 
Domain Number 23 Region: 2419-2454
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000017
Family LDL receptor-like module 0.00091
Further Details:      
 
Domain Number 24 Region: 2459-2499
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000209
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 25 Region: 2541-2581
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000223
Family LDL receptor-like module 0.00095
Further Details:      
 
Domain Number 26 Region: 3081-3123
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000353
Family LDL receptor-like module 0.00083
Further Details:      
 
Domain Number 27 Region: 103-148
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000393
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 28 Region: 2219-2257
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000393
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 29 Region: 3331-3368
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000563
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 30 Region: 66-107
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000101
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 31 Region: 2587-2625
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000107
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 32 Region: 3375-3419
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000114
Family EGF-type module 0.023
Further Details:      
 
Domain Number 33 Region: 195-227
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000119
Family LDL receptor-like module 0.00077
Further Details:      
 
Domain Number 34 Region: 3124-3164
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000144
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 35 Region: 955-991
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000183
Family LDL receptor-like module 0.00077
Further Details:      
 
Domain Number 36 Region: 1083-1122
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000516
Family EGF-type module 0.0059
Further Details:      
 
Domain Number 37 Region: 868-912
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000017
Family LDL receptor-like module 0.00077
Further Details:      
 
Domain Number 38 Region: 273-319
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000303
Family EGF-type module 0.026
Further Details:      
 
Domain Number 39 Region: 2636-2676
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000349
Family EGF-type module 0.01
Further Details:      
 
Domain Number 40 Region: 2338-2377
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000497
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 41 Region: 3412-3447
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000533
Family EGF-type module 0.0039
Further Details:      
 
Domain Number 42 Region: 2968-3003
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000055
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 43 Region: 231-347,468-522
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000119
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 44 Region: 1653-1700
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000153
Family EGF-type module 0.012
Further Details:      
 
Domain Number 45 Region: 1348-1392
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000158
Family EGF-type module 0.014
Further Details:      
 
Domain Number 46 Region: 2668-2710
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000255
Family EGF-type module 0.0032
Further Details:      
 
Weak hits

Sequence:  adi_v1.00468
Domain Number - Region: 3481-3585
Classification Level Classification E-value
Superfamily YWTD domain 0.000249
Family YWTD domain 0.01
Further Details:      
 
Domain Number - Region: 789-822
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00103
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 1037-1064
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00785
Family LDL receptor-like module 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) adi_v1.00468
Sequence length 3585
Sequence
MHVFWCKMGAQSCFFFLPVLTFTYVIYFVDEGCEETEFRCGDGTCIHKSWRCDGTEDCYD
ASDEAACAHVTCSSLEFPCNNGRCIPLTWQCDGDIDCLPNKEDEHNCSNHTCASHDFTCA
NGMTCIDRRWVCDRDDDCGDMSDEVDCPTGEPCKEDKFTCQNGVCIHPNWVCDGANDCSD
WSDEVNCTTKKCDATTEFRCSNGPCININWKCDGDTDCSDASDEKDCGAATCSSNQWQCI
GTSHCLEMNQVCDGNNDCGDNSDEGTHCLSRDCLKLKNCSHNLCRQTPKGPECLCRRGYL
LDSDGVSCNDVNECLTVGTCDHFCTNTNGSYKCFCDEGYVFIPPQTCRPQDWGIHKIERA
GMDGSNRTVIAHTNVYWPNALTLDYPTRRIYWADSHFDYIGSMTYNGGERRRILGYPYVA
HPFALTVFRNYLYFSDWMRHAVVKVNKFTGNESGILFGHLGQPMDLKVYHSSRQPYIHNP
CNHSSNCGCEQLCLLSPVSPNGCVCSCMIRYKLSADNKSCIQQDTFLIYAKGIEIAGMPI
ETNASRDMIMPILGLGNAMGLDYDAREQMIYFSDILRNNISRFSIMDRKLEVLVKPVPNA
DGIAVDWLGRNLYWTDAGEHEVAVAKLNGSFKKVLFRDGVSRPRAIVLHPVEGKMYWSDW
NSPAKIEAANMDGTARDILVQGGGLSWPNGLAIDYQARKLYWADAWTDYIECAEFDGSNR
TVIVKGLTHPFGLDVDNGFVYWTDWRSKNIQRTSISDPSSLVVLRSGLKYLMEIRVYDPK
RQTGKSPCDGSCSHLCLLYPGGFRCACPSGMSLEDGSNTTCTVNASATLAPLCPSNKFAC
KNGNCIPNNWRCDGANDCADKSDEDAFAGCPTATCSETQFQCLRSGKCIPLDWYCDEDND
CGDGDLSDESNCTSSQCTNAQFLCSNGKCLPISWHCDGLDDCGDNSDEIKCDNKNCSDQF
FSCASGRCVPMDWRCDGDDDCGDLSDENSCPEQPCLQSEFRCRVGTCIPGRWRCDGLFDC
PDSSDEVDCSSGLPSCYGDADMFLCNNSRCIAKDFVCDYYDDCGVECSCFNGFSLVNNSS
CRDIDECANPGSCSQRCFNSIGSFTCKCTEGYKLEYDQRHCKATGSITPYLYFSTWLGMR
KIDLRYGFDYSVVADHLMGTTVLDYDFRNDKLYMYYRGIITNKIRRCTLNGSACEDVITT
GIPFIRALAVDWISGNLYWTDAHTKNIEVANLSNKWRMVLISDDLEGPYDIAVDPRDGRL
YWIDGYLEYIGFCSYNGLHRHTIPTNGLKLRHPFSLTLFEDMIYFSDLAKLSVYQLNKFH
GGNHTLIHSDLLRAFDLNVVHPLRQPNGVNFCAKSKCSHWCLLKPQGYSCHCPMGFQLLD
DNITCQDNSVFLLYAEKTAIRAISIESNNTKEQMIPVSDCIIAVGVDFSFEERMVFWSDV
GADTISRVFLNGSGHQTVVSRELSRPEGISFDWTAKNLYWTDTGENIVGVARYDGSYRKD
LISSNISKPRAIIVHPLLGLLFWSDWDDVHPRIERAMMDGSNRTQIKTSDLKFPNGLAID
FTTQRLYWCEAGTKVIGSMYFDGTAQQVHLQLNSMHAFSLSLYNGTFFWSDWNSKSIFKS
STNGSFQAFLKPRKDKVYDVRVFSKENQPGSSGCTFNNGNCTQLCFPLGSMSVKCACAIG
YHLVADGKTCDSIHTFLIYSTGAAIYGIALDPNNSEKVMEPLETPRNLLAIDLYANSSLI
FYSNERTKTISQVSRVGTARKTVISSGLRRPKGLAVDWVAGNLFWADSGNNVIEVSRLNG
SFRTVVISSRLQDPRSIAVHPARGLMFWTDHGRTPAVERSAMDGTGRFALVRGTNVRGPV
GITIDYVEEKVYWLDDILRVLWKMDLDGGNLQAVVSSLSRPYGLTLFDRFVYWTDRKNLT
LFRANKYNGTSVEVVATGSAKGLRDVRVFSPNRQLSRGACQNNGGCEELCLATSAIDRRL
VQRLRNPSSVALDWITKEIYWVESTTGSINKAFVNGSHRQTLKTGTKDSFPLTVIVLPCL
KLLVWAELATSRLMVIKASNTDGSGVRTVANRTSPWTFASAPSMTYDYSQGRLYWTGHSE
YIVESAFLNGTDHRVVLSRYHVSTVGILGNFMYWFNKRQRTVMRAVKLVDADPFVLAALN
YPVVDLKVFSKERQNCTINPCLNGGGCSHFCHVQGQGRLCSCPAGLALKDDFQCVNRSVL
CPEGQFACTNGKCISDSFVCDKQDSCGDSSDELPAWCAQRQCQADEFRCSSGQCINSHWK
CDFGRDCTDGSDEKGCAPKTCAMHRFTCANGHCINIEWKCDGDNDCGDFSDETDCRSLTC
SPGKAKCGDTNACIDSTWLCDGDSDCKNGWDESEAVCNKTCGAGSFRCSSGHCISLQWRC
DGVDDCGDGSDEVLCKKHNITCSSRQFTCRNGRCISMKFKCDGDDDCGDRSDESLSDLHC
DKRTCDPTEFRCENRARCVPMSFVCDGENDCGDASDEHPKEGCEYRTCKPTQFRCANGLC
VQKAWLCDREDDCGDNSDETNCANHACNSNQFTCSDGYCVPRSYMCDGEDDCSDSSDEDP
VACGRTPAPSCPRRSFSCGNGTCVALNKVCDGHEDCVNGADEWRCKHGACRRPDLNQCSQ
LCHSNPTGYTCSCRPGFVLQADGASCDDSDECANYDLNKCNHFCVNLKGHYKCTCAKGYA
LEPNDTHTCKPLNRSVLPYLAFLQRYEVRKLAADGSWEVEMLHKIQNAFAIDFDWSEQRV
YWTEDHKPPRVKRAFFNGTGMEVVLDVGLSKVEGLAVDWVGRNLYLVDSIQAKIFVVTTA
GRHMKTLVSEGLQEPRVVVVDPREGYLFYSDWGKRPHIGKCALDGSSGCVIVISKHIGRA
NDLSLCQITKRLFWVDAKRHAIESCDLNGRNRVQLTALNAPHPFAISVFEDYVYWTEWLP
MAIHRADRLTGLQHTVLLNSSHKLMGIQAPCRMFECGNKTCVSPIVVCNGHEDCGNGADE
TLCAVRQCAPFQFRCANHKCVFISHVCNGVNDCGDNSDEQHCKNTTCAEDRFTCPSGRCI
SRQWLCDGVNDCGDETDESQSMCWSHVCNETQFQCNVSRKCISKYWKCDGVNDCEDGSDE
SAETCEGNQCDVDMIQCHNKRCIPRDLRCDSEDDCKDGSDEVDCPSHTCTNSEFRCGSGQ
CINSEWLCDGADDCTDSTDEQDCANASCRAHQFQCANGECIAKLWTCDGHRDCKDASDEQ
DCPTRPSSVPQCLPQHFACSNTLCIHKVWVCDGDDDCGDGSDESLKLCADHSCPYTKFRC
ANNVCIPKWQYCDGVDQCGDGSDESTCPVTIYGCNPNQFKCSNRKCIANAFVCDSRDDCG
DASDEKYCGANNKSCNFENGGCEQKCTTVEGAVVCRCWRGFQLSKETRKCEDLDECQTVG
ACSQLCLNTRGSYKCQCKAGYVSIGANCKAEGQAASLLFPSSGDIRTLIVNGNGTGSYDA
IAHSQASTGALGVSWEKQLVFWTDLRQGTIKRARIPSMTSVISILPHNKQSFFAVITACC
VCNPDAARVIEVANKDGYYRYKLFSSDNGNMPYALVVDPPNSRIY
Download sequence
Identical sequences adi_v1.00468

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]