SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for adi_v1.01889 from Acropora digitifera v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  adi_v1.01889
Domain Number 1 Region: 1028-1091,1123-1171
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 0.000000000000159
Family DNA/RNA non-specific endonuclease 0.006
Further Details:      
 
Domain Number 2 Region: 760-798
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000602
Family LDL receptor-like module 0.0025
Further Details:      
 
Domain Number 3 Region: 969-1014
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000131
Family TSP-1 type 1 repeat 0.0011
Further Details:      
 
Weak hits

Sequence:  adi_v1.01889
Domain Number - Region: 719-755
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000216
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) adi_v1.01889
Sequence length 1305
Sequence
MEEMIAREHSFTVNKKRSCRDIPCYLIFLLFWAGMVTIAIIALQRGDPLRLYHGFDSYGN
VCGRKENPNTPNVTLSGMDMSDRPYLLYFDLTKTKLGKFFVNPLLDKVSPKLREDFKSSL
TNDDLQINEDTSALMICVKRCPDHFMLTTEQFKKYKEETGANVCTYNTVITADTKQDTLL
GPCPPFVLPTMPVLNRCIPLLGVANKKLKAVGDILKRTDTEIFGFSRKLISDVYSSWKYL
VIICLLAFVLSFVMMLCLGLLAQITTYVIGLVILCASIFFTCWIWYAYYVERTNTIDFSV
ELGLPSYEGSEKTLLTIAIIATCVASIIICMILFLRKSIALMVAIFKEVGVAMATIPSML
VVPPLYLVCILGLVCTWLIISVYIYTASKPAATAFGTVVYTQPSYTAYVWAYYVIGLFWG
VQFLLAALEMTLAGAFADYYAVDQEAMLSLPLLKSFWRMIRYHLGSLAFGSLILVIARLF
RYTIKVIMRETQRNAHHSLVAEFIGKCFQCCFWCLEKFLKFINRNVYIQIAAQGDSFCSA
TKNVFSILTHNPTHFVVISSIGSFFLFLAKLVVVVLSFVAGYYFLRLFHCDHISGIIAPV
MIGSVIAYVIAYVFFYVFKIGVDTFLVCYCFENSLSNQLNEKASKEEFIKQAEKERRGEM
QMIRKAILKNKTSKRRLNRDCSKWCIAVLCALIFLVLLFGLVFVLYFEVWDQSLCTGTDY
TPCSPGFCVHGECKQRDGLAFCDCARGYTGRKCDLNETVPCNQSSHFVCHMSRECFNASK
QCDGHLDCSDSTDEMDCPPGTVWPPRVPTTTKQASTPTSTRATAVTAATLPYTAFKTTTP
AVTTNGTDSSITTKLPTKVSTESPPQTTTKLPTKVSTESPPQTTTKFPPEISTESPPPPV
GPKWPPIXCPEIPLSILVFVLIPVVLVPPFIPGTSLNPSPNNPEQTKPSPDLPTLKPTPP
EECKKPKPVDGQWTQWSAWQDAGTQSTRFRYCNSPKPRDGGKVCPGEPCEKRECEEKEKT
ITCMNSDNVNRMEASFTYTNLVPQFSDLNQEAWRLAEIAIRDWFVGKECDPKSTYLLTGT
VPSEMYLGYGEVFVDMQKDKIPQNMNRLLCKRGTVFCDTKYRVNIPAYTWTAGACHDLTG
NCKTFSLLAKNDGHENSVGFYNLDTLEKFLGAKSLTLSTCWTNKKLDRDDFRNRFLRTEQ
NGQKLINRASDVSVKLFPGCTKVNTDYSQEFVKYFKSRSWSHFLHSYIPPYVEKKRQQLL
QNLEDQKKHSPSFTSVLEDIQHAVDDLDTIVESDLTGTPLSNCDY
Download sequence
Identical sequences adi_v1.01889

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]