SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for adi_v1.02031 from Acropora digitifera v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  adi_v1.02031
Domain Number 1 Region: 1-178
Classification Level Classification E-value
Superfamily Tubulin nucleotide-binding domain-like 1.02e-51
Family Tubulin, GTPase domain 0.0000917
Further Details:      
 
Domain Number 2 Region: 200-252
Classification Level Classification E-value
Superfamily Tubulin C-terminal domain-like 0.000000977
Family Tubulin, C-terminal domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) adi_v1.02031
Sequence length 269
Sequence
MIDMESKAISQTLSQAKKSGKWCYPEGQQFCQKRGSGNNWAHGFLEHGPKSLERVLDMVH
KEVEKCDRFGGFLIFMSLAGGTGSGVGAYITGSLRDEFPHSFILNQVVWPYGTGEVIVQN
YNAILTLSHLYRCSDGVVILENDKLQNICSRLMNLKHISFKDINKVISHKLASVLQPVKL
FSQGQNAGFYKHATSVRNLLGDLIEQVCPHPEYKLMTLKNIPQMSEKSLAYSTYTWTGLL
KHLRQMLIADASMEEGIDWEVKIPVTIQP
Download sequence
Identical sequences adi_v1.02031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]