SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for adi_v1.02736 from Acropora digitifera v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  adi_v1.02736
Domain Number 1 Region: 57-89
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000288
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 2 Region: 18-52
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000111
Family LDL receptor-like module 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) adi_v1.02736
Sequence length 96
Sequence
MPGRSQPLLVCQTSCDVANALYFNCPSGKCLRTDLLCDSDKNCDDGTDEMKCGLGMGCSK
DEFSCADGGCVSWALTCNGEKDCEDGTDEPLFCKKQ
Download sequence
Identical sequences adi_v1.02736

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]