SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for adi_v1.02746 from Acropora digitifera v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  adi_v1.02746
Domain Number 1 Region: 150-183
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000223
Family LDL receptor-like module 0.0044
Further Details:      
 
Domain Number 2 Region: 506-540
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000393
Family LDL receptor-like module 0.0037
Further Details:      
 
Weak hits

Sequence:  adi_v1.02746
Domain Number - Region: 360-400
Classification Level Classification E-value
Superfamily FnI-like domain 0.00136
Family VWC domain 0.076
Further Details:      
 
Domain Number - Region: 71-106
Classification Level Classification E-value
Superfamily FnI-like domain 0.00377
Family Fibronectin type I module 0.047
Further Details:      
 
Domain Number - Region: 31-67
Classification Level Classification E-value
Superfamily FnI-like domain 0.0345
Family Fibronectin type I module 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) adi_v1.02746
Sequence length 620
Sequence
MERRGFLDVFMYGPNATAVYICSSFSTIGFSCAENQRKTRKPGDVWLQDPRTNCTCTSNN
SVACKRLSEPVCLDVSGKFRKNFETWLNGSCVECACVNGSINCTEYDVIITPGLYKVDVS
PTCQLCDIRLQTALSSNACIAFRQERAKLTECASGGFYIRNTHLCNGIEECPDGSDEKSC
ENVVCKDEEGKVLVMKSTGAWNVSRCLRCLCIEGLVACKRTLTVFFPAFFGATYQHEETC
KQPTCNILEFVRNNRKWCEGVELIKDRGIIYEGQTWKANGCDFYFNGSLNYQECPLMTRP
VCYVFNGFVCCASQCPALQQIAGQMRGNLSFCANGRQVASNNSDCKDTSNCVQDINIQNC
SSEVTCQDEDGNQYFEGATWSVGSCMQCACISGIIRCSREVSLVKFLELTPLENQRSLTV
FTERCNQPECNVAKYMEKNTGVCHACRWNDKLYYDGDHWKENGVDFFCTRSSYESHRIRP
GCYVESRRVKCTGAIAGIRQLSLISNYQLFLCDSGDEIRPISDRCNIRADCEDFSDERNC
ENYYCSHETAHGFLWNRTRLGQQVLKECSLVNPTWTGLFGSKCGQKVAGTVWDHKHICNC
ENRTLLEYFKKNVSLTTDLI
Download sequence
Identical sequences adi_v1.02746

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]