SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for adi_v1.02750 from Acropora digitifera v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  adi_v1.02750
Domain Number 1 Region: 176-212
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000367
Family LDL receptor-like module 0.0038
Further Details:      
 
Domain Number 2 Region: 886-1153
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000165
Family Rhodopsin-like 0.025
Further Details:      
 
Weak hits

Sequence:  adi_v1.02750
Domain Number - Region: 528-563
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000209
Family LDL receptor-like module 0.003
Further Details:      
 
Domain Number - Region: 390-426
Classification Level Classification E-value
Superfamily FnI-like domain 0.00157
Family VWC domain 0.067
Further Details:      
 
Domain Number - Region: 97-132
Classification Level Classification E-value
Superfamily FnI-like domain 0.00889
Family Fibronectin type I module 0.058
Further Details:      
 
Domain Number - Region: 54-93
Classification Level Classification E-value
Superfamily FnI-like domain 0.0314
Family Fibronectin type I module 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) adi_v1.02750
Sequence length 1155
Sequence
MCSSCFSISAPNCTDSQGNTRQIGETWKEGILSTCSCTGPMKMQCSSAVRPPPTIFSCTD
NQRNTREPGDVWLKDPKTNCTCTSNNSVACEQLSQPVCLDVSGQFRKNFETWLNGSCVEC
ACVNGSINCTEYDVIITPGLYKVDVSPTCQLCDIRLQTALSSNACIAFRDQRAKLTECAS
GGFYIQGTHLCNGMEECPDGSDEKNCENVVCKDEEGKVLVMKSTGGWIVSKCLRCLCIEG
LVTCNRTLTVFFPAYFGAVYEHEETCKQPSCKILDFVRNNKKRCEGAELIKDRGIIYEGQ
TWKANGCDFYFNGSLNYQECPLMTRPVCYVFNGFVCCASQCPALQQIAGQMRGNLSFCAN
GRQVASNNSDCKDTSNCLQNINIQNCFSEVTCQDEDGNQYFEGATWSVGSCMQCACVSGI
IQCSRVVSLVSFLKLNQPIGAVTFTESCNQSECNVAKYMEKNAGVCHACRWNDKLYYDGD
HWKENYVDFFCTKTSHESPRVRPGCYVESRRVKCTGAIAGIRQLTLISNHQLFLCDSGDE
IRPIRDRCDIGADCEDFSDERNCENYYCSYETAHGFLWNKTRLGQQVLRECSLVNPTWTG
LFGSKCGQNVARTVWDHKHICNCENRALLEYFKKNNAKVNSTNFFNVSEDLAISGKAKEF
PNPRIFLRLNEELFLNITSRFLTPLTLDNANLALQYCLSFIDTMRNSPQYSVKDTFCKAE
LAEERDSLIEKALEFLRQAPGQTEAHRVGWGPNNLPALVLDRAYGNTLSVVVKNFQEKQL
FGLGRRLLFLQLNTAPLVSPIVEQKTTPGNTVREKNVTSKNRTNQNTTRTTHNDSTRDPA
IKQVKDLLRANNCTELTYEEEKDVFIFKIDVSAEELKHEQVQSDMEIVLLCISIAAIILA
LVLLTVLRLKKTERLFIHKSLLFSLGVGNLVFVLDKTLFASRKDHPALCSVVAVVQHYLH
TAVFTWMLVEGINLYIKLVKVFSFKKLYAIYLAIGWGVPAVIVGLGASIPPSTFDMAESE
TTEITCGALNLTATKQRTRCWMNGNLWIYKGPILAILLVNFVLFAILLRVIFGKISSKYG
NNHVILARKGLRSIIALLPLLGVTWLLGFFIEFHYILTYLFIWLNSIQGVVFFIFHCILD
NEVQGAMRKFLVKHR
Download sequence
Identical sequences adi_v1.02750

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]