SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for adi_v1.02959 from Acropora digitifera v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  adi_v1.02959
Domain Number 1 Region: 120-294
Classification Level Classification E-value
Superfamily L domain-like 2.28e-37
Family Ngr ectodomain-like 0.011
Further Details:      
 
Domain Number 2 Region: 315-565
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 3.48e-37
Family Rhodopsin-like 0.0016
Further Details:      
 
Domain Number 3 Region: 48-85
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000072
Family LDL receptor-like module 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) adi_v1.02959
Sequence length 580
Sequence
MVNPDACAVYYTLKFPNNKSNVAFKMDRNCNYENRCNATKNQGPGKPCNFSDSFKCRNNL
CVPNYWQCDGKDDCGDRSDEHDCPYEFDTSKEACSWTSHCVKDGWEAHLGNETPVIKSLA
ICSRKNITAIPTYLPTKLTVLLIPGGKIARIERFNFARYSSLRKIDLERNQITRIEPRSF
INQHQLKTLILKSNKIRVLETGTFKGLVKLTELILSDNPIEKIEKGAFYGLEKLRCLNLS
NMKLSSISSGAFNGMDSLRELYLGNNENLQQLPLDIFSSISLRFLQADKFEFCCIARLSG
PQCAAPKDLFSSCNNLMANMTLRLSIWILGSIALFGNAFVLLWRLKTKSDNRVHALLLLN
LAIADFFMGIYLALIGSVDAFYRGRYFIYNDRWKHSPLCQFSGFVSTLSSEASVMILTVM
TMDRYVTIVHPFKHFGLSIRGAHVILIITWIAAFVLAGVPLTGIPYLKEFYARSGVCLPL
HLTADKPAGWEYSVFLFLALNFASFMIIFFLYLIMFLKIQKTRKLSGAGPAVSSIGSRMV
FIVLTDFCCWIPIIIIGIASLVDDRNYQNGSILVLTITRS
Download sequence
Identical sequences adi_v1.02959

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]