SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for adi_v1.03287 from Acropora digitifera v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  adi_v1.03287
Domain Number 1 Region: 82-196
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.16e-21
Family MAM domain 0.0068
Further Details:      
 
Domain Number 2 Region: 45-77
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000144
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 3 Region: 7-40
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000484
Family LDL receptor-like module 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) adi_v1.03287
Sequence length 217
Sequence
QICDVADVTNFNCPSGKCLRADLLCDSDKNCDDGTDEMRCGLGMGCSKDEFSCADGGCVS
WALTCNGENDCEDGTDEPLFCKKQGRYMFIESSTYYQTDVSAVLASDVIDKGEIICVQFW
YYMRGQDIGSLKIYIRTDISKTLIWQLTGEQGNKWVFGQVGHKDDSSSYQVLLEGAFNGS
GINRVIAVDDLYFSSEKECLTLPTKGNGSCSVSLLCS
Download sequence
Identical sequences adi_v1.03287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]